Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 206139 DVU0714 branched-chain amino acid ABC transporter, permease protein
Query= uniprot:A0A165KER0 (358 letters) >MicrobesOnline__882:206139 Length = 317 Score = 210 bits (534), Expect = 5e-59 Identities = 132/346 (38%), Positives = 193/346 (55%), Gaps = 47/346 (13%) Query: 1 MKNTKTNWIIGAVALLVLPLILQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGY 60 M + K ++ AV + VLPL L + W + LY +LAL LN+++G AGL +G+ Sbjct: 1 MISRKASYAGLAVLIAVLPLFLDPY---WTDVCVSIGLYAVLALSLNLILGQAGLFHMGH 57 Query: 61 VAFYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPT 120 AFYAVGAY A++ + + H + +PVA LLAA F ++ P Sbjct: 58 AAFYAVGAYTAAILNTVY----------------HVPVLWTMPVAGLLAALFALVVARPI 101 Query: 121 LKLRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFG 180 + LRGDYL IVT+G EI+RI L N + +T G G +FG+ R +FG Sbjct: 102 IHLRGDYLLIVTIGIVEIVRIALIN--NVFGITGGANG--------IFGIS---RPMLFG 148 Query: 181 FDINSVTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLA 240 + I+ +YYL V +S+++ RL+ SR GRA I+ED++AA+ G++T KL A Sbjct: 149 YKISKPIQFYYLIWTWVAISILLFRRLECSRFGRALNYIKEDDVAAEGSGVDTAYYKLAA 208 Query: 241 FGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSAL 300 F +GA + G++G + A +SPESFS ESV++ A+V+LGG G GV+LGA LL L Sbjct: 209 FVLGALWAGMTGTFYAAKMTIISPESFSFWESVVLFAIVILGG-GSNRGVLLGAFLLIGL 267 Query: 301 PEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWP 346 PE+ R D A R L+ LAM+++M+ RP+G+ P Sbjct: 268 PELFR--------------DFASARMLIFGLAMVVMMIFRPQGMLP 299 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 317 Length adjustment: 28 Effective length of query: 330 Effective length of database: 289 Effective search space: 95370 Effective search space used: 95370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory