Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate 206140 DVU0715 branched-chain amino acid ABC transporter, ATP binding protein
Query= uniprot:D8IUY7 (241 letters) >MicrobesOnline__882:206140 Length = 255 Score = 124 bits (312), Expect = 1e-33 Identities = 78/251 (31%), Positives = 133/251 (52%), Gaps = 17/251 (6%) Query: 4 NILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGH 63 ++L ++ L+ +GG+ AV + +V+EG +V LIG NGAGKTT ITG G Sbjct: 2 SLLSLRNLTKTFGGLVAVNSVSFDVDEGSIVGLIGPNGAGKTTVFNLITGNYKPD--SGD 59 Query: 64 IEYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADI--- 120 I + G+ +KG + +V+ +A + +F MS+ EN+L G + G +A + Sbjct: 60 IFFDGRAIKGLLTHRIVQMGIARTFQTIRLFQNMSVMENVLAGCHCRMTAGVFSAMLGTA 119 Query: 121 ----DKWFAV--------FPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPS 168 ++ A+ F L ++ +A LS G Q++L +ARAL + P+ ++LDEP+ Sbjct: 120 GHRREEKRAIERAVRELEFVGLADQHDNLAKNLSYGNQRLLEIARALATDPRFIILDEPA 179 Query: 169 MGLSPIMVEKIFEVIRNVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQML 228 G++ + IR + +GI++LL+E + L ++ + V+E G + +G + Sbjct: 180 GGMNDQETAALIGTIRAIRDRGISVLLIEHDMSLVMKVCEKLVVLEYGALIAEGTPSVIK 239 Query: 229 DDPRVKAAYLG 239 DPRV AYLG Sbjct: 240 RDPRVIEAYLG 250 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 255 Length adjustment: 24 Effective length of query: 217 Effective length of database: 231 Effective search space: 50127 Effective search space used: 50127 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory