Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate 206141 DVU0716 branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >MicrobesOnline__882:206141 Length = 238 Score = 242 bits (618), Expect = 4e-69 Identities = 122/236 (51%), Positives = 171/236 (72%), Gaps = 2/236 (0%) Query: 6 LKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHIE 65 L+++ L V YG ++A+ GID+ V+EGE+VT++GANGAGKTTTL +I+G + S EG + Sbjct: 3 LELRNLHVKYGNVEALHGIDIRVDEGEIVTILGANGAGKTTTLMSISGLVKPS--EGGVF 60 Query: 66 YLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKWFA 125 + +PL S E+V + PEGR VF +S+ ENL +GA+T DK ++ + F Sbjct: 61 FRDEPLHKLHSHEVVARGITQSPEGRRVFGTLSVLENLYLGAFTCRDKARVERTLGWIFE 120 Query: 126 VFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIRN 185 +FPRL+ER Q+AGTLSGGEQQMLA+ RALM PK+LLLDEPS+GL+PI+V+ IF+ +R Sbjct: 121 LFPRLEERRGQLAGTLSGGEQQMLAIGRALMGDPKVLLLDEPSLGLAPILVKSIFDTVRT 180 Query: 186 VSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYLGEG 241 ++ G+T++LVEQNA+ AL+ A RGYVME G + M+ A +L +P V+AAYLG G Sbjct: 181 INQSGVTVVLVEQNARAALKLATRGYVMEVGRVVMEDSAASLLANPEVQAAYLGGG 236 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 238 Length adjustment: 23 Effective length of query: 218 Effective length of database: 215 Effective search space: 46870 Effective search space used: 46870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory