Align HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate 207785 DVU2298 glycine/betaine/L-proline ABC transporter, permease protein
Query= TCDB::Q9KKE2 (285 letters) >MicrobesOnline__882:207785 Length = 283 Score = 246 bits (629), Expect = 3e-70 Identities = 134/275 (48%), Positives = 183/275 (66%), Gaps = 4/275 (1%) Query: 11 RAPVNDFIQALVTNY----GWVFKAISGVILKAVLFIEWILRGLPWWLVILAFMALACRS 66 R P+ +++A N +A S V + +E +L +P W I LA R+ Sbjct: 8 RIPLGAWLEAFTDNMVEWCSGATRAFSTVAGNGIDMLESLLGSIPPWAFIPVVALLAWRA 67 Query: 67 SRRWSLTLAVCALLETVGVLGIWDLTMQTLALMLMATIVSVVIGVPMGILVAKSRVVRNI 126 +R+ + + LG+W+ TM T+AL+L+AT ++VV GVP+GI A + VR + Sbjct: 68 TRKPGIGAFALLGFGLIWNLGLWEATMSTIALVLVATALAVVTGVPLGIAAAVNVTVRKV 127 Query: 127 TLPVLDVMQTMPSFVYLIPALMLFGLGKVPAILATIIYAVPPLIRLTDLGIRQVDAEVVE 186 +PVLD+MQTMP+FVYLIPA+ FGLGKV A+ AT+++A+PP IR T LGIRQV ++VE Sbjct: 128 LMPVLDLMQTMPAFVYLIPAIPFFGLGKVAAVFATVVFAMPPAIRFTCLGIRQVPDDLVE 187 Query: 187 AATAFGGSPGQILFGVELPLATPTIMAGLNQTIMMALSMVVVASMIGARGLGEQVLNGIQ 246 A AFG S Q L +ELPLA PTI+AG+NQTIM+ALSMVV+A+MIGARGLG +V IQ Sbjct: 188 CAEAFGTSRWQRLVKLELPLAAPTILAGVNQTIMLALSMVVIAAMIGARGLGGEVWKAIQ 247 Query: 247 TLDVGKGLEAGIGIVILAVVLDRITQGFGKPRTED 281 L++G G EAGIGIVI+A+ LDR+ Q G+ + D Sbjct: 248 RLELGSGFEAGIGIVIVAICLDRVLQHIGRRSSVD 282 Lambda K H 0.327 0.142 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 283 Length adjustment: 26 Effective length of query: 259 Effective length of database: 257 Effective search space: 66563 Effective search space used: 66563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory