Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate 206675 DVU1236 amino acid ABC transporter, ATP-binding protein
Query= TCDB::Q93A35 (328 letters) >MicrobesOnline__882:206675 Length = 247 Score = 157 bits (398), Expect = 2e-43 Identities = 97/241 (40%), Positives = 144/241 (59%), Gaps = 8/241 (3%) Query: 1 MIRFDNVSKKYSDDKTAAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTI 60 +I NV K + + A+++V+LD++ GE V IGPSG GK+T L+ INRL + G+I Sbjct: 8 IISIRNVWKFFGE--LTALHDVSLDVQAGEKVVIIGPSGSGKSTLLRSINRLENVDKGSI 65 Query: 61 YINEK--RISDYDIHELRWDIGYVLQQIALFPHMTIEENIAIVP-ELKKWSKEKIHDRIT 117 ++ K R D DI+ +R D+G V Q LFPH T+ +N+ + P L+K +++ R Sbjct: 66 IVDGKDIRAEDSDINVIRQDLGMVFQSFNLFPHKTVLQNLTMAPMRLRKVPRDEAESRAL 125 Query: 118 ELLDSVGLDPESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQ 177 +LL VG+ ++ + PA LSGG+QQRV + RALA +P I+L DEP SALDP + Sbjct: 126 DLLKKVGISDKANVY--PAMLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMIGEV- 182 Query: 178 QDISALQKKIKKTIVFVTHDMQEALALGDRICVMQGGEIVQVATPQEIMKNPENDFVKDF 237 D+ K T+V VTH+M A + DRI M G+I++ TPQ + PE+ ++ F Sbjct: 183 LDVMVTLAKEGMTMVCVTHEMGFAREVADRIIFMDHGQILEQGTPQHFFEAPEHPRLQKF 242 Query: 238 L 238 L Sbjct: 243 L 243 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 247 Length adjustment: 26 Effective length of query: 302 Effective length of database: 221 Effective search space: 66742 Effective search space used: 66742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory