GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Desulfovibrio vulgaris Hildenborough

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate 208482 DVU2969 acetoacetyl-CoA synthase

Query= SwissProt::P27550
         (652 letters)



>lcl|MicrobesOnline__882:208482 DVU2969 acetoacetyl-CoA synthase
          Length = 661

 Score =  746 bits (1927), Expect = 0.0
 Identities = 367/623 (58%), Positives = 462/623 (74%), Gaps = 8/623 (1%)

Query: 25  EAMYQQSINVPDTFWGEQG-KILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLD 83
           EA+ +++   P+ FWGE+  +++DW KP+  V +         I+W++ G LN+A NCLD
Sbjct: 35  EALVRRAAEDPEGFWGERAAQLIDWFKPWDTVLDADM--NEPRIEWFKGGRLNVAHNCLD 92

Query: 84  RHLQENG-DRTAIIWEGDDASQSKHISYKELHRDVCRFANTLLELGIKKGDVVAIYMPMV 142
           RH+  N  ++ AIIW+G+     + ++Y+ L+ +V RFA  L ++G+ KGD V++YMPM+
Sbjct: 93  RHVAGNRRNKAAIIWQGEPEEDVRVLTYQMLYDEVRRFAAVLRKMGVHKGDRVSLYMPMI 152

Query: 143 PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNV 202
           PE AVAMLACARIGAVHS++F GFS  ++  RI D  +++V+T+D  +RAGR IPLK NV
Sbjct: 153 PELAVAMLACARIGAVHSIVFAGFSAVSLQNRIHDCEAKVVVTADAVLRAGRRIPLKVNV 212

Query: 203 DDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDLVEQAS--DQHQAEEMNAEDPLF 260
           D+A++     SVE VVV+ R   ++  +EGRDLWWH+++   +       EEM+AED LF
Sbjct: 213 DEAVRQ--CPSVEKVVVVNRGSLEVTMEEGRDLWWHEVMADRTLDVDRPCEEMDAEDMLF 270

Query: 261 ILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGP 320
           ILYTSGSTGKPKGV+HTTGGYL YAA T ++VFD    D+YWCTAD+GW+TGHSY++YGP
Sbjct: 271 ILYTSGSTGKPKGVVHTTGGYLTYAAHTTQWVFDVQDDDVYWCTADIGWITGHSYIVYGP 330

Query: 321 LACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSL 380
           LA GAT+LMFEGVP+WP+P R  ++V+K +VNI YTAPT +RALM EG    E  D SSL
Sbjct: 331 LALGATSLMFEGVPSWPSPDRFWRIVEKFRVNIFYTAPTVVRALMREGTDWTERHDLSSL 390

Query: 381 RILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPGATELKAGSATRP 440
           R+LGSVGEPINPEAW WY   IG  + P+VDTWWQTETGG MI+ LP AT LK GSAT+P
Sbjct: 391 RVLGSVGEPINPEAWMWYHTHIGKGRLPIVDTWWQTETGGIMISGLPYATTLKPGSATQP 450

Query: 441 FFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGD 500
             GV  A+V  +G+P      G LVI   WPG  R +FG  ER+  TYF  F  MY SGD
Sbjct: 451 LPGVDAAIVRPDGSPAGPNEGGHLVIRKPWPGMLRGIFGSPERYRSTYFERFPGMYESGD 510

Query: 501 GARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHNIKGQAIY 560
           GAR D DGY+WI GR+DDV+NVSGHR+GTAE+ESALVAHP +AEAAVVG+PH +KG+AIY
Sbjct: 511 GARTDTDGYFWIMGRLDDVINVSGHRMGTAEVESALVAHPSVAEAAVVGMPHAVKGEAIY 570

Query: 561 AYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAA 620
           AYVTL    E + EL AE+R WVRKEIGP+ATPDVL + + LPKTRSGKIMRRILRKIAA
Sbjct: 571 AYVTLGADAEETEELRAELRAWVRKEIGPIATPDVLQFAEGLPKTRSGKIMRRILRKIAA 630

Query: 621 GDTSNLGDTSTLADPGVVEKLLE 643
           G TS  GDTSTLADPGVV  L+E
Sbjct: 631 GATSEFGDTSTLADPGVVSDLIE 653


Lambda     K      H
   0.317    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1389
Number of extensions: 64
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 652
Length of database: 661
Length adjustment: 38
Effective length of query: 614
Effective length of database: 623
Effective search space:   382522
Effective search space used:   382522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory