Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate 209026 DVU0097 polyamine ABC transporter, permease protein
Query= CharProtDB::CH_088337 (275 letters) >MicrobesOnline__882:209026 Length = 295 Score = 281 bits (718), Expect = 2e-80 Identities = 134/265 (50%), Positives = 186/265 (70%) Query: 2 IVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDPLYFEVLLHSLNM 61 I + WL LF LPN ++ + L R + FV+ VFTL NY RL DP + +L S+ + Sbjct: 12 IAVVALWLGLFALLPNAGLLLVTVLQRGEQDFVEPVFTLANYARLFDPTFLRILWDSIAL 71 Query: 62 ALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLN 121 A +T CL++GYPFA+ +A VRP L L+I+PFWTNSLIR Y L I L ++G ++ Sbjct: 72 AATSTFVCLLVGYPFAYRIAMARRSVRPWFLLLVIIPFWTNSLIRTYALIILLKSQGLVS 131 Query: 122 EFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASK 181 + LL+LG ID PI +M++ AV +GL Y LLPFM++PLY SI+KLD+ LL+AA+DLGA Sbjct: 132 DVLLFLGFIDAPISLMYSDLAVFVGLTYTLLPFMILPLYVSIDKLDRKLLDAAKDLGAGS 191 Query: 182 LQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWP 241 L+ F + +PLTMPGI+AG +LV LP++ FY+ +++GGAK +LIGN IK QFL RDWP Sbjct: 192 LRAFWHVTLPLTMPGIVAGSMLVFLPSLACFYIPEILGGAKAMLIGNFIKNQFLVARDWP 251 Query: 242 FGAATSITLTIVMGLMLLVYWRASR 266 GAA S LT+++ L+++ +W ASR Sbjct: 252 LGAAASTILTLLLVLLIVAWWLASR 276 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 295 Length adjustment: 26 Effective length of query: 249 Effective length of database: 269 Effective search space: 66981 Effective search space used: 66981 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory