Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate 206400 DVU0968 amino acid ABC transporter, ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >MicrobesOnline__882:206400 Length = 246 Score = 114 bits (285), Expect = 2e-30 Identities = 78/249 (31%), Positives = 133/249 (53%), Gaps = 22/249 (8%) Query: 6 ILTARGLVKRY---GRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGE 62 I++AR + K + + AL D+ PGE++ +IG +G+GKS+ ++ ++ D GE Sbjct: 3 IISARNVNKYFYVPEELHALRDVSLDVAPGEVVVIIGPSGSGKSTFLRCLNRLEYADSGE 62 Query: 63 IRLEGKPI-QFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSL 121 I +EG+ I + + +A + V+Q+ L P LS+ +N+ L + R Sbjct: 63 ILIEGRDILDPKCEINEVRAEVGMVFQSFNLFPHLSVLENVALAQMT---------VRKR 113 Query: 122 DRAAMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAA 181 RA EK+ L+++G+ + + LSGGQ+Q VA+AR+ A K+++ DEPT+A Sbjct: 114 SRAESEKKGMELLTKVGIADKHAVYP--DQLSGGQQQRVAIARSLAMDPKIMLFDEPTSA 171 Query: 182 LGVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMS 241 L + VL+++ ++ R G+ +V+++H M EVADR+ G L + PKD Sbjct: 172 LDPEMVGEVLDVMRNLAREGMTMVVVTHEMGFAREVADRVVFMDHGAILEIATPKD---- 227 Query: 242 DAVAFMTGA 250 F TGA Sbjct: 228 ---LFTTGA 233 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 246 Length adjustment: 24 Effective length of query: 236 Effective length of database: 222 Effective search space: 52392 Effective search space used: 52392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory