Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 209488 DVU0549 high-affinity branched-chain amino acid ABC transporter, permease protein
Query= uniprot:A0A165KER0 (358 letters) >MicrobesOnline__882:209488 Length = 407 Score = 254 bits (648), Expect = 4e-72 Identities = 155/351 (44%), Positives = 207/351 (58%), Gaps = 55/351 (15%) Query: 13 VALLVLPLILQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFYAVGAYLFA 72 V VLP+++ ++ I ALLYV+L LGLNIVVG +G L LGYVAFYAVGAY +A Sbjct: 98 VVFAVLPMLVSTYQT---NIMISALLYVMLGLGLNIVVGLSGQLVLGYVAFYAVGAYAYA 154 Query: 73 LMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAIVT 132 L+ A F F W V+P+ LAA FG +LG P L+L+GDYLAIVT Sbjct: 155 LLN--------ADFGLGF--------WTVLPIGGALAAVFGILLGFPVLRLKGDYLAIVT 198 Query: 133 LGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINSVTLY-YY 191 LGFGEI+R+ L N ++T GP G+ +I +FG++L ++ T Y YY Sbjct: 199 LGFGEIVRLVLENWG---SVTRGPSGISKIARPGLFGMELS---------VSEATTYIYY 246 Query: 192 LFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFGMGASFGGVS 251 L L V+ ++ RL+DSRIGRAW A+REDEIA +AMGI+ KL AF +GA + G + Sbjct: 247 LILAAVIFTIFAVGRLKDSRIGRAWQALREDEIACEAMGIDLTTTKLTAFALGACWAGFA 306 Query: 252 GAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSALPEVLRYVAGPL 311 G +F A F++P SF+ +ES MI+AMVVLGG+G GV+LGA++L LPE LR + Sbjct: 307 GVIFAAKTTFINPASFTFLESAMILAMVVLGGMGSTLGVVLGALVLILLPEYLRAFSE-- 364 Query: 312 QAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWP---------SPEHGKS 353 R L+ AM+++M+ RP+GL PE GKS Sbjct: 365 ------------YRMLIFGAAMVLMMVFRPQGLVSCRSREYDVNDPEAGKS 403 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 407 Length adjustment: 30 Effective length of query: 328 Effective length of database: 377 Effective search space: 123656 Effective search space used: 123656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory