Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate 209489 DVU0550 high-affinity branched-chain amino acid ABC transporter, ATP binding protein
Query= TCDB::P21629 (255 letters) >MicrobesOnline__882:209489 Length = 262 Score = 236 bits (602), Expect = 4e-67 Identities = 118/255 (46%), Positives = 172/255 (67%), Gaps = 5/255 (1%) Query: 5 ILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGG--LI 62 +L+V ++ FGGL A+N V+L+V+ ++V++IGPNGAGKTT FNC+TG Y PT G ++ Sbjct: 4 VLDVRSISKNFGGLRALNEVDLRVDAGEIVALIGPNGAGKTTFFNCITGIYVPTEGEVVV 63 Query: 63 RLDGEE---IQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFK 119 G E + G +++ G+ RTFQN+RLF+ MT +EN+++ H + L L + Sbjct: 64 TRPGSEPVRVNGQKPNQVTELGMARTFQNIRLFQNMTVLENVMIGCHCRTRSGILGALLR 123 Query: 120 TPAFRRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDE 179 R E+E ++ + L+ V+L + A L YG QRRLEIAR + T P +L+LDE Sbjct: 124 DAKTRGEEQEIIDKSYELLKSVHLQQHYKEQARNLPYGAQRRLEIARALATNPFLLLLDE 183 Query: 180 PAAGLNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPE 239 PAAG+NP+ET +LK L+ ++R N++VLLIEHDM +VMS+SD I V+ G+ +A+GTPE Sbjct: 184 PAAGMNPQETLELKGLVLEIRERLNLSVLLIEHDMNMVMSLSDRIYVMEYGSKIAEGTPE 243 Query: 240 QIRDNPDVIKAYLGE 254 ++ NP VIKAYLGE Sbjct: 244 EVSRNPRVIKAYLGE 258 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory