Align Sorbitol-6-phosphate 2-dehydrogenase; EC 1.1.1.140; Glucitol-6-phosphate dehydrogenase; Ketosephosphate reductase (uncharacterized)
to candidate 206645 3-oxoacyl-(acyl-carrier-protein) reductase
Query= curated2:P37079 (267 letters) >MicrobesOnline__882:206645 Length = 259 Score = 117 bits (293), Expect = 2e-31 Identities = 83/259 (32%), Positives = 127/259 (49%), Gaps = 31/259 (11%) Query: 13 IVTGGASGIGLAIVDELLSQGAHVQMIDIHGGDR--------HHNGDNYHFWSTDISSAT 64 IVTGG+ GIG A+ + L G V + + D G + + D+S A Sbjct: 21 IVTGGSRGIGKAVAETLARAGLQVFLTYVSKPDEAEAVAAGIRDAGGSATAFRLDVSDAA 80 Query: 65 EVQQTIDAIIQRWSRIDGLVNNAGVNFPRLLVDEKAPAGRYELNEAAFEKMVNINQKGVF 124 V + I+ R+D LVNNAG+ L++ + + FE+++++N G F Sbjct: 81 AVAAFFQSEIKDKVRLDVLVNNAGITKDGLIM---------RMKDEDFERVLDVNLCGAF 131 Query: 125 FMSQAVARQMVKQRAGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKYGIR 184 + ++ M +QR G I+N++S G G+ GQ+ Y A KA L T+S +KEL + Sbjct: 132 TCLREASKLMTRQRLGRIINITSVVGQMGNAGQANYCAAKAGLIGLTKSAAKELAARNVT 191 Query: 185 VVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYTKNAIPIGRAGKLSEVADFVCY 244 V VAPG +E T + E++R+ Y + AIP+ R G ++AD V + Sbjct: 192 VNAVAPGFIETD------------MTAGLP-EEVRKAYVE-AIPLRRLGSAQDIADAVAF 237 Query: 245 LLSARASYITGVTTNIAGG 263 L S RASYITG + GG Sbjct: 238 LASERASYITGQVLAVNGG 256 Lambda K H 0.316 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 259 Length adjustment: 25 Effective length of query: 242 Effective length of database: 234 Effective search space: 56628 Effective search space used: 56628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory