GapMind for catabolism of small carbon sources

 

Alignments for a candidate for dctQ in Desulfovibrio vulgaris Hildenborough

Align C4-dicarboxylate TRAP transporter small permease protein DctQ (characterized, see rationale)
to candidate 206130 DVU0706 membrane protein, putative

Query= uniprot:Q9KQS0
         (232 letters)



>MicrobesOnline__882:206130
          Length = 156

 Score = 53.9 bits (128), Expect = 2e-12
 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 28  IEEFLIAFFMGAMTLLTFANVIMRYLFNDNILWALEGTVFMFAWMVLVGASFGVKRHFHI 87
           IE  L A  M A+TL+T ANV+MRY  N +     E +VF+   + LVGA        H+
Sbjct: 11  IERALAALVMAALTLITGANVVMRYCTNVSFAMTEEVSVFLLMVLTLVGAVSAFAEGRHV 70

Query: 88  GVDVLINIAPARLRKLYALVAVACCLA-FSILLLIGSWNYWHPFITE 133
            + + +N  P   RK+   +A  C +A F +L  + +   W  +  E
Sbjct: 71  RITLFVNSLPDTGRKVCNALAWMCNVAMFGMLTWLAALVAWDDYSFE 117


Lambda     K      H
   0.329    0.140    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 112
Number of extensions: 9
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 232
Length of database: 156
Length adjustment: 20
Effective length of query: 212
Effective length of database: 136
Effective search space:    28832
Effective search space used:    28832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory