Align C4-dicarboxylate TRAP transporter small permease protein DctQ (characterized, see rationale)
to candidate 206130 DVU0706 membrane protein, putative
Query= uniprot:Q9KQS0 (232 letters) >MicrobesOnline__882:206130 Length = 156 Score = 53.9 bits (128), Expect = 2e-12 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 1/107 (0%) Query: 28 IEEFLIAFFMGAMTLLTFANVIMRYLFNDNILWALEGTVFMFAWMVLVGASFGVKRHFHI 87 IE L A M A+TL+T ANV+MRY N + E +VF+ + LVGA H+ Sbjct: 11 IERALAALVMAALTLITGANVVMRYCTNVSFAMTEEVSVFLLMVLTLVGAVSAFAEGRHV 70 Query: 88 GVDVLINIAPARLRKLYALVAVACCLA-FSILLLIGSWNYWHPFITE 133 + + +N P RK+ +A C +A F +L + + W + E Sbjct: 71 RITLFVNSLPDTGRKVCNALAWMCNVAMFGMLTWLAALVAWDDYSFE 117 Lambda K H 0.329 0.140 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 112 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 156 Length adjustment: 20 Effective length of query: 212 Effective length of database: 136 Effective search space: 28832 Effective search space used: 28832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory