Align UTP--glucose-1-phosphate uridylyltransferase; Alpha-D-glucosyl-1-phosphate uridylyltransferase; General stress protein 33; GSP33; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase; EC 2.7.7.9 (characterized)
to candidate 206724 DVU1283 UTP-glucose-1-phosphate uridylyltransferase
Query= SwissProt::Q05852 (292 letters) >MicrobesOnline__882:206724 Length = 292 Score = 276 bits (705), Expect = 5e-79 Identities = 137/284 (48%), Positives = 194/284 (68%) Query: 4 VRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRA 63 +RK +IP AG GTR LPATK +PKEMLP+ +KP +QY++EEA ++GI D++ VT + K+ Sbjct: 5 IRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAQKSGIGDVVFVTNRDKKI 64 Query: 64 IEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNFIGD 123 IEDHFDY+ +LE LE GKTE+L +V++ + + +I +RQK+ GLGHAV CAR + D Sbjct: 65 IEDHFDYNLQLESVLERAGKTEMLRQVREVAEMVNIISVRQKKQLGLGHAVLCAREIVRD 124 Query: 124 EPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEGRRY 183 EPFAV++GDD++ TPG++QL+D +IGV +VP ++ RYGII + Y Sbjct: 125 EPFAVMVGDDLMFGMTPGIQQLIDVAVAEHLPVIGVMEVPADKVSRYGIIAGEETAPGIY 184 Query: 184 QVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEIQRV 243 +V VEKP APS LAI+GRYV TP+IF LE+ + G GGEIQLTDA+Q L + + + Sbjct: 185 KVSRLVEKPSIAEAPSRLAIVGRYVLTPDIFDSLEKVKPGHGGEIQLTDALQNLADDRGL 244 Query: 244 FAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLL 287 A G R+D G+ ++T + FA+Q++ LRD L+ + LL Sbjct: 245 LAVKIRGMRFDAGDWAEYLTANIYFALQEEGLRDDLISQLRPLL 288 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 292 Length adjustment: 26 Effective length of query: 266 Effective length of database: 266 Effective search space: 70756 Effective search space used: 70756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 206724 DVU1283 (UTP-glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.20295.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-107 344.0 0.2 3.6e-107 343.8 0.2 1.0 1 lcl|MicrobesOnline__882:206724 DVU1283 UTP-glucose-1-phosphate Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:206724 DVU1283 UTP-glucose-1-phosphate uridylyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 343.8 0.2 3.6e-107 3.6e-107 1 261 [] 5 265 .. 5 265 .. 0.99 Alignments for each domain: == domain 1 score: 343.8 bits; conditional E-value: 3.6e-107 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleaklekkn 79 irk+viP+aG+Gtr LPatk iPkemlp+ +kP++qyvveea ++Gi ++v+vt+r+k+ iedhfD++++le+ le+++ lcl|MicrobesOnline__882:206724 5 IRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAQKSGIGDVVFVTNRDKKIIEDHFDYNLQLESVLERAG 83 89***************************************************************************** PP TIGR01099 80 keellkevrkiaelatilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeeealkqlielyektgasiiavee 158 k+e+l++vr++ae+++i+ vrqk++ GLGhavl+a+e+v depfav++gDdl+ ++ ++qli++ + +i+v+e lcl|MicrobesOnline__882:206724 84 KTEMLRQVREVAEMVNIISVRQKKQLGLGHAVLCAREIVRDEPFAVMVGDDLMFGMTPGIQQLIDVAVAEHLPVIGVME 162 ******************************************************************************* PP TIGR01099 159 vpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkggeiqltDalrlllek 237 vp+++vs+YG+i+gee+ +y+v+ lvekP+ eaps laivGrYvltp+if+ le++k+G+ggeiqltDal+ l+++ lcl|MicrobesOnline__882:206724 163 VPADKVSRYGIIAGEETAPGIYKVSRLVEKPSIAEAPSRLAIVGRYVLTPDIFDSLEKVKPGHGGEIQLTDALQNLADD 241 ******************************************************************************* PP TIGR01099 238 eevlavklkgkryDvGdklgylka 261 +lavk++g r+D Gd +yl+a lcl|MicrobesOnline__882:206724 242 RGLLAVKIRGMRFDAGDWAEYLTA 265 *********************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.24 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory