Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate 209272 DVU0339 D-isomer specific 2-hydroxyacid dehydrogenase family protein
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >MicrobesOnline__882:209272 Length = 301 Score = 136 bits (343), Expect = 6e-37 Identities = 95/279 (34%), Positives = 136/279 (48%), Gaps = 13/279 (4%) Query: 29 ATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVL 88 A D + L+ G + +T +++ LK +S G D D +GI + Sbjct: 36 ALTEDEAIDILQGCVGVAAGTEPLTRRVMDALPGLKVISRCGTGMDSVDRVAAEEKGIAV 95 Query: 89 ANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVG 148 NTPD T + A+ L R+V + ++ G W+ +G L GK +G+VG Sbjct: 96 RNTPDGPTLAVAELTLGYALDLMRQVTRMDHELRGGTWKKRMGNLL-----NGKKVGLVG 150 Query: 149 LGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTP 208 GRIG A AR F +V +++ P AE+A +++E+ L+ AD + L Sbjct: 151 FGRIGRATARLFE-AFGAEVAFSD----PYAEDATH-QKMEMDALMGWADIISLHCSKPA 204 Query: 209 ETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDS 268 HLI A L M++ LINA+RG VDE AL +AL +G + GA LDVFE EP Sbjct: 205 GGGHLIDATRLGLMREGTWLINAARGGLVDEAALHDALASGRLAGAALDVFEQEPY--TG 262 Query: 269 PLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 PL L NV+ PH+GS E R M + NL+ AL G Sbjct: 263 PLRDLPNVILTPHVGSYAVEARIRMETDTIRNLLDALKG 301 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 301 Length adjustment: 27 Effective length of query: 294 Effective length of database: 274 Effective search space: 80556 Effective search space used: 80556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory