Align ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized)
to candidate 209035 DVU0105 glutamine ABC transporter, ATP-binding protein
Query= TCDB::Q9R9Q4 (342 letters) >MicrobesOnline__882:209035 Length = 244 Score = 158 bits (399), Expect = 2e-43 Identities = 93/238 (39%), Positives = 138/238 (57%), Gaps = 7/238 (2%) Query: 4 LQLRDIRKSFGAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGTLAFD 63 +++R++ KS+G V++G+ + ++ GE +V +GPSG GKST LR I LEEITSGT+ D Sbjct: 5 IEIRNLHKSYGDHHVLRGIDLTVRTGEVVVVIGPSGSGKSTALRCINRLEEITSGTIIVD 64 Query: 64 GQIV----NQLTPSRRGIAMVFQSYALYPHMTVYENMAFG-MQLAGKDKQQCRKRVEAAA 118 G + + R MVFQ + L+PHM+V EN+ G +++ +Q+ + A Sbjct: 65 GYDLYDPKTDINHVRTEAGMVFQQFNLFPHMSVLENVTIGPVKVRRMARQEAQALGLALL 124 Query: 119 EMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATRLEIAK 178 E + L P QLSGGQ+QRVAI R++ PKV LFDEP S LD L V LE+ K Sbjct: 125 EKVGLADKAHAYPDQLSGGQKQRVAIARSLAMQPKVLLFDEPTSALDPEL-VGEVLEVMK 183 Query: 179 LHRSMHKTTMIYVTHDQVEAMTLADRICVLRDGLVEQIGTPLELYETPNSVFVAGFIG 236 + TM+ VTH+ A +ADR+ + G +++ G P EL+ P + + F+G Sbjct: 184 -QLAREGMTMVVVTHEMGFAREVADRVIFIDYGKIQEEGPPNELFADPKNPRLREFLG 240 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 244 Length adjustment: 26 Effective length of query: 316 Effective length of database: 218 Effective search space: 68888 Effective search space used: 68888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory