Align D-lactate dehydrogenase (EC 1.1.1.28); D-lactate dehydrogenase (acceptor) (EC 1.1.99.6) (characterized)
to candidate 206254 DVU0827 glycolate oxidase, subunit GlcD, putative
Query= BRENDA::Q9YEU4 (473 letters) >MicrobesOnline__882:206254 Length = 471 Score = 244 bits (624), Expect = 3e-69 Identities = 163/472 (34%), Positives = 247/472 (52%), Gaps = 42/472 (8%) Query: 7 ELEKIFGPEKVVSDPHIVRLYSREPSGLEGRAEAVVFPESAQDVSRLVRYAYSREVYIYP 66 E +++F E+ + ++ + S G AVV P + V L+R+A + + +YP Sbjct: 30 EGDRLFSAEETL-------VFGTDASRKCGTPLAVVRPTTEAQVVELLRWADAERLPVYP 82 Query: 67 QGSSTDLAGGAFPERPGVVVSMERMRRVREVSVLDSVAVVEPGVRLWDLNVELSKYRYMF 126 + +T++ GG P+RPG+V+S RM R+ ++ D VAVV+PGV DL + + Sbjct: 83 RARATNVVGGCVPQRPGIVLSTLRMARIIDIDEHDFVAVVQPGVITADLQRAVEARGLFY 142 Query: 127 PIDPGSVKVATVGGAINTGAGGMRGARYGTMRDWVLGLEIVLPDEEGTILRVGCRTLKCR 186 P DP S ++++GG + T AGGMR RYG RD+VLGL VLP G +L G R K Sbjct: 143 PPDPASQNISSIGGNVATCAGGMRAVRYGVTRDYVLGLRAVLPG--GEVLATGSRCHKNV 200 Query: 187 QGYDLARLIVGSEGTLAIVTEAILKITPMPENVVVVLAFFPTLRQLVDAVIEVKSRAIDT 246 G DL RL+VGSEGTL +TE LK+ P+PE +LA F L +DAV V + I Sbjct: 201 VGLDLVRLLVGSEGTLGCLTEVTLKLLPLPEATASLLAGFSDLGAAMDAVRNVFAAGILP 260 Query: 247 LLMEFMDVDSARLAA--------ETLGAAI--RPDGHMLLVGVPVNREASTRVLEEMVSI 296 + +EFM + AA +T+ AA+ R DG + + V+R A Sbjct: 261 VALEFMGPEVLDCAALLNDVPWPKTVRAALLFRLDGSRAALPLEVDRLA----------- 309 Query: 297 AKAAGAASVYTAKSMEEAEEKKLLEIRRSLFATQALLTQKQFKGRKVMMLMEDIAVPPSK 356 A AA V++A + EE+ L IRRS+ L+ K + +D+ VP + Sbjct: 310 AAVRDAAPVWSAVGVGRDEEEPLWTIRRSINPASFLV--------KPDKMSDDVTVPRGR 361 Query: 357 LLDAVERLKELEAKYGFKTVLGGHIGDGNLHPTISYPVDDEKAKEAALKWYYDVMRMAIE 416 L +A+E ++ + + GH+GDGN+H I + + +E AL +V + + Sbjct: 362 LREALEGIRAIAEARSLTILTFGHVGDGNIHVNIMHDASVTEEREHALAAKGEVTDLILS 421 Query: 417 LGGTVSAEHGIGVLKKEALRLELERMGSVKALEIMAGIKRVFDPKGILNPGK 468 LGGT+S EHG+G+ K + +L ++ +MA +K FDP GI+NPGK Sbjct: 422 LGGTLSGEHGVGLTKAPYVHRQLSKL----ERGLMAQVKAAFDPHGIMNPGK 469 Lambda K H 0.319 0.136 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 524 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 471 Length adjustment: 33 Effective length of query: 440 Effective length of database: 438 Effective search space: 192720 Effective search space used: 192720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory