Align Aminomethyltransferase; EC 2.1.2.10; Glycine cleavage system T protein (uncharacterized)
to candidate 207143 DVU1684 glycine cleavage system T protein
Query= curated2:Q31KT1 (372 letters) >MicrobesOnline__882:207143 Length = 376 Score = 256 bits (653), Expect = 9e-73 Identities = 160/370 (43%), Positives = 213/370 (57%), Gaps = 22/370 (5%) Query: 9 LLSSPLHSVCTSAGARFTGFAGWELPLQFQGLMQEHLAVRERAGLFDISHMGKFQLRGSG 68 LL +PL++ + GA+ FAGW++P+Q++G++ EH R A LFDI HMG+F LRG G Sbjct: 18 LLLTPLNAWHRAQGAKMAPFAGWDMPIQYEGILAEHQHTRTHAALFDICHMGEFALRGPG 77 Query: 69 LRAALQRLLPSDLTTLLPGQAQYSVLLNEAGGCLDDLIVYWQGIVDGVEQAFLIVNAATT 128 + AL R + +L TL PG+ +Y LLNEAG LDDLIVY + L+VN A Sbjct: 78 AKQALARAVTHNLETLKPGRCRYGFLLNEAGCVLDDLIVYCL----AEDDYMLVVNGACI 133 Query: 129 DSDRLWLTEHLPPAIALLDLSQDLALVAIQGPQAIAFLQPLVSCDLAELPRFSHTVTSIA 188 SD L E LP ++ D+S A + +QGP++I L+ L+ EL F+ T T+ Sbjct: 134 ASDFAALRERLPASLHFEDISAATAKLDLQGPKSIDALEGLLGRSFRELGYFAFTHTTFD 193 Query: 189 GQPAFVARTGYTGEDGCEVMLPPAAAITLWQQLTA-AGVVPCGLGARDTLRLEAAMPLYG 247 G V+RTGYTGE G E+ LP A TLW +L A V P GLGARDTLRLE +PLYG Sbjct: 194 GANLMVSRTGYTGELGYELYLPWDKAETLWTRLLENADVKPAGLGARDTLRLEVGLPLYG 253 Query: 248 HELDTDTNPLEAGLGWVVHLDRNPDFLGRDRLVQAKTNGLERRLVGLELPGRNIARHGYP 307 +LDT P EAG + L D++G+ R + LV L +PGR ARHG Sbjct: 254 QDLDTTHTPAEAGYEGM--LTNTVDYVGKGR-----DREVREVLVPLAIPGRRAARHGDA 306 Query: 308 VAIAD-TTVGIVTSGSWSPTLSKAIALAYVPPALAN----LGQELWVEIRGKQVPATVVK 362 VA+ D T VG+VTSGS++P++ A+ALAYV A + + VE+ K+ P Sbjct: 307 VALPDGTVVGVVTSGSFAPSVGHAVALAYVKKPHAEEDSFIIKAARVELEAKRAPL---- 362 Query: 363 RPFYRGSQFR 372 PFY G R Sbjct: 363 -PFYAGGTAR 371 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 376 Length adjustment: 30 Effective length of query: 342 Effective length of database: 346 Effective search space: 118332 Effective search space used: 118332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate 207143 DVU1684 (glycine cleavage system T protein)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.14460.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-90 290.1 0.0 1.4e-90 289.8 0.0 1.0 1 lcl|MicrobesOnline__882:207143 DVU1684 glycine cleavage system Domain annotation for each sequence (and alignments): >> lcl|MicrobesOnline__882:207143 DVU1684 glycine cleavage system T protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 289.8 0.0 1.4e-90 1.4e-90 4 337 .. 21 343 .. 18 365 .. 0.95 Alignments for each domain: == domain 1 score: 289.8 bits; conditional E-value: 1.4e-90 TIGR00528 4 tpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllanDvdaLtkGkaq 82 tpL h +g+k+ +faGw +P+qy+++ eh+ +rt+a lfD+ hmg++ l+G+ + ++L r ++ +++ L +G+ + lcl|MicrobesOnline__882:207143 21 TPLNAWHRAQGAKMAPFAGWDMPIQYEGILAEHQHTRTHAALFDICHMGEFALRGPGAKQALARAVTHNLETLKPGRCR 99 99***************************************************************************** PP TIGR00528 83 ysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisllalqGPkaktiledlldk 161 y lln G v+DDlivy +ed ++lvvn a++ D + l+e+l+ + +++++s + l lqGPk+ + le ll + lcl|MicrobesOnline__882:207143 100 YGFLLNEAGCVLDDLIVYCLAED-DYMLVVNGACIASDFAALRERLPASLHFEDISAATAKLDLQGPKSIDALEGLLGR 177 ***********************.9****************************************************** PP TIGR00528 162 aveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkPiGLgarDtLrleagmaLyGqe 240 + +l f+f ++ + + + +++rtGytGe G+e++++ +ka lw +l+e+ vkP GLgarDtLrle g++LyGq+ lcl|MicrobesOnline__882:207143 178 SFRELGYFAFT-HTTFDGANLMVSRTGYTGELGYELYLPWDKAETLWTRLLENADVKPAGLGARDTLRLEVGLPLYGQD 255 **********9.889999999********************************************************** PP TIGR00528 241 ldeeitPleaglgwvvkkerkksdfiGravleeqkengtekklvGlemlekgiarnelkvlltngekevGivtsGtlsP 319 ld + tP eag + +++ d++G+ ++ ++++ lv l + + +ar++ v l++g + vG+vtsG+++P lcl|MicrobesOnline__882:207143 256 LDTTHTPAEAGYEGMLTNT---VDYVGKG-----RDREVREVLVPLAIPGRRAARHGDAVALPDG-TVVGVVTSGSFAP 325 **********999888777...8999986.....67778888***********************.************* PP TIGR00528 320 tLgknialayvdkeleki 337 +g+++alayv+k ++ lcl|MicrobesOnline__882:207143 326 SVGHAVALAYVKKPHAEE 343 ***********9876654 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.81 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory