Align Uncharacterized protein (characterized, see rationale)
to candidate 208547 DVU3033 iron-sulfur cluster-binding protein
Query= uniprot:B2TBW0 (256 letters) >MicrobesOnline__882:208547 Length = 717 Score = 110 bits (276), Expect = 6e-29 Identities = 74/253 (29%), Positives = 117/253 (46%), Gaps = 19/253 (7%) Query: 7 KELMKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQPMANSGAHAEAAG 66 K +++ALF C D YPE A ++++ + +D+P +Q+CCG P+ G Sbjct: 471 KPKLRIALFSGCVQDFVYPEQMKAAVKVIASQNVDIDFPMDQSCCGLPVQMMGEREATIE 530 Query: 67 TER--VFARNFAGYDYIVGPSASCIHHVREHLTAL-----EQTDEVKKVRANAYELVEFL 119 R V A + A YDYIV ASC H++E L E T V++ + F+ Sbjct: 531 VARQNVMAFDAARYDYIVTLCASCASHLKETYPKLLTGHPEMTTRVRQFSNKIIDFSSFV 590 Query: 120 HDVVGAREFPWAEFPH-RVGLHNSCSALRHLKEASISEVAGAPFSKPRTLLEGVKGIEFV 178 HDV+G + + + +V H+SC R L +PR L+ G + Sbjct: 591 HDVLGMKSDAFKGGSNEKVAYHSSCHLCRGL----------GVVEQPRNLI-AASGATYC 639 Query: 179 KPARPDECCGFGGTFSVTEEPVSVRMGQDKVRDHLNAGAEYIVSGDMSCLMHQQGCAERM 238 K D CCGFGGTFS +S + + K+ + GA +V+ C+M +G E+ Sbjct: 640 KAEEEDVCCGFGGTFSAKFPELSAELLRKKLDNVEATGAGRLVADCPGCIMQLRGGMEKR 699 Query: 239 KADARFIHIAQVL 251 + H+A++L Sbjct: 700 GGKVKVGHVAELL 712 Lambda K H 0.323 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 717 Length adjustment: 32 Effective length of query: 224 Effective length of database: 685 Effective search space: 153440 Effective search space used: 153440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory