GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Desulfovibrio vulgaris Hildenborough

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3); aldehyde dehydrogenase [NAD(P)+] (EC 1.2.1.5) (characterized)
to candidate 208845 DVU3319 proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase

Query= BRENDA::P11884
         (519 letters)



>lcl|MicrobesOnline__882:208845 DVU3319 proline
           dehydrogenase/delta-1-pyrroline-5-carboxylate
           dehydrogenase
          Length = 1006

 Score =  235 bits (599), Expect = 7e-66
 Identities = 155/478 (32%), Positives = 237/478 (49%), Gaps = 25/478 (5%)

Query: 49  DAVSKKTFPTVNPST-GEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLL 107
           D  +    PT NP+   EV+  + +  + ++D A+ AA+ A      WR    +DR   L
Sbjct: 520 DVTTADLIPTTNPAKPAEVVASICQAGRPEIDDAIAAAKKA---ALTWRDTSPADRAAYL 576

Query: 108 YRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAG-----WADKYHGKT 162
            R AD+  +    L+A + ++ GK +  +Y  D+   +  L YYA       A +  G+ 
Sbjct: 577 RRAADICRKRIWELSAWQVVEVGKQWDQAYH-DVTEGIDFLEYYAREMLRLGAPRRMGRA 635

Query: 163 IPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALY 222
                  F    ++P G+   I PWNFP  +       A+ TGN V+ K +  +      
Sbjct: 636 PGEHNHLF----YQPKGIAAVIAPWNFPFAIAIGMASAAIVTGNPVIFKPSSISSRIGYN 691

Query: 223 VANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQ-----VAAG 277
           +A + +EAG P GV N  PG     G  +  H D+  + FTGS EVG  IQ     V  G
Sbjct: 692 LAEVFREAGLPEGVFNYCPGRSSIMGDYLVEHPDISLICFTGSMEVGLRIQEKAAKVQPG 751

Query: 278 SSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEF 337
               KRV  E+GGK+  II  DAD+D AV Q  ++ F  QGQ C A SR  V + +YD F
Sbjct: 752 QRQCKRVIAEMGGKNATIIDDDADLDEAVLQVLYSAFGFQGQKCSACSRVIVLDAIYDRF 811

Query: 338 VERSVARAKSRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRG 397
           +ER V  A S  +G   D     GP  D T  K +  YI+  ++EG  LL      A+ G
Sbjct: 812 IERLVKAASSIHIGPSEDPSNYMGPVADATLQKNVSDYIRIAEEEGRVLLKRTDLPAE-G 870

Query: 398 YFIQPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDK 457
            ++  T+ GD++    IA+EEIFGPV+ +++  T +E +  AN +++ L  AVF++  + 
Sbjct: 871 CYVPLTIVGDIRPEHRIAQEEIFGPVLAVMRAATFDEALSIANGTRFALTGAVFSRSPEH 930

Query: 458 ANYLSQALQAGTVWIN--CYDVFGAQSPFGGYKMSGSGRELG--EYGLQAYTEVKTVT 511
            +   +  + G +++N         + PFGG+ MSG G + G  +Y LQ + + + VT
Sbjct: 931 LDKARREFRVGNLYLNKGSTGALVERQPFGGFAMSGVGSKTGGPDYLLQ-FMDPRVVT 987


Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1095
Number of extensions: 56
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 519
Length of database: 1006
Length adjustment: 40
Effective length of query: 479
Effective length of database: 966
Effective search space:   462714
Effective search space used:   462714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory