GapMind for catabolism of small carbon sources

 

Aligments for a candidate for thuK in Desulfovibrio vulgaris Hildenborough

Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate 208681 DVU3161 ABC transporter, ATP-binding protein

Query= SwissProt::Q9YGA6
         (372 letters)



>lcl|MicrobesOnline__882:208681 DVU3161 ABC transporter, ATP-binding
           protein
          Length = 349

 Score =  290 bits (743), Expect = 3e-83
 Identities = 168/368 (45%), Positives = 226/368 (61%), Gaps = 25/368 (6%)

Query: 1   MAGVRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQI 60
           M+ + L  V + +G+V AV ++S EV+ G+ ++LLGPSGCGK+TTLR+IAGLE  + G+I
Sbjct: 1   MSTIVLDKVSRHWGDVRAVDDVSFEVEQGDMLVLLGPSGCGKSTTLRLIAGLESVTSGRI 60

Query: 61  YIGDKLVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRV 120
            IG + V +      +PP  R +AMVFQSYAL+PH+TV DNI F L +RKVP  E  +R+
Sbjct: 61  LIGGRDVTN------LPPAQRQLAMVFQSYALFPHLTVRDNILFGLVVRKVPAAERQKRL 114

Query: 121 REVAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRA 180
               E+LGL +LL RKP ELSGGQ+QRVALGRA+V +  V LMDEPLSNLDAKLR  MR 
Sbjct: 115 DRAVEILGLGKLLERKPGELSGGQQQRVALGRALVAEAAVCLMDEPLSNLDAKLRQEMRR 174

Query: 181 ELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFI 240
           E++ LQ+ LG+T +YVTHDQ EAM+M DRI +M  G + Q  +P E+Y +PA  F   FI
Sbjct: 175 EIRALQQTLGMTMVYVTHDQTEAMSMADRIILMQGGRIVQNATPTEMYSRPATAFAGSFI 234

Query: 241 GSPPMNFLDAIVTEDGFVDFGEFRLKLLPDQFEVLGELGYVGREVIFGIRPEDLYDAMFA 300
           G+PPMN +     +DG    G    ++            + G + + GIRPE        
Sbjct: 235 GTPPMNLVRLQGNDDGIRVAGSRSGRV----------TCHAGADCMLGIRPE-------- 276

Query: 301 QVRVPGENLVRAVVEIVENLGSERIVHLRVGGVTFVGSFRSESRVREGVEVDVVFDMKKI 360
            +R+  +   RAVVE VE LGS  ++  RVG           +    G E+ +    + +
Sbjct: 277 HIRIVDDGW-RAVVESVEYLGSNSVLSCRVGSEELSVVVHGVTDTVVGAEIYLHCPEEHV 335

Query: 361 HIFDKTTG 368
           HIFD  TG
Sbjct: 336 HIFDAATG 343


Lambda     K      H
   0.323    0.142    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 369
Number of extensions: 14
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 372
Length of database: 349
Length adjustment: 29
Effective length of query: 343
Effective length of database: 320
Effective search space:   109760
Effective search space used:   109760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory