Align TreV, component of Trehalose porter (characterized)
to candidate 207786 DVU2299 glycine/betaine/L-proline ABC transporter, ATP binding protein
Query= TCDB::Q97ZC0 (324 letters) >MicrobesOnline__882:207786 Length = 397 Score = 155 bits (392), Expect = 2e-42 Identities = 82/217 (37%), Positives = 128/217 (58%), Gaps = 6/217 (2%) Query: 25 IETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADITDKPPEK------RNVAM 78 +E GE V++G SG GKSTL++ L + + G + DG D+T P ++ R+ M Sbjct: 50 VEEGEIVVVMGLSGSGKSTLVRCLNRLIEPTAGTVTVDGRDVTSMPVDELRRLRQRSFGM 109 Query: 79 VFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGISEILDKKVTQISGGQQ 138 VFQN+AL+P+ +V N AF L+ G+ + E + + + +G++E + Q+SGG Q Sbjct: 110 VFQNFALFPHRTVLQNAAFGLEAMGVPRAERERQAMVSLERVGLAEWAASRPAQLSGGMQ 169 Query: 139 QRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKELKGTFIYVTHDQKEALS 198 QRV LARA+ +P L+DE S LD +R + EL R+Q +L+ T ++++HD EAL Sbjct: 170 QRVGLARALSLDPDILLMDEAFSALDPLIRRDMQDELLRLQDDLQKTIVFISHDLDEALK 229 Query: 199 LADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGE 235 L DRI ++ G Q+ P+ + P +VA+FVGE Sbjct: 230 LGDRIVLMRDGAVVQIGTPEDILTNPADDYVARFVGE 266 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 397 Length adjustment: 29 Effective length of query: 295 Effective length of database: 368 Effective search space: 108560 Effective search space used: 108560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory