Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate 206675 DVU1236 amino acid ABC transporter, ATP-binding protein
Query= uniprot:P70970 (276 letters) >MicrobesOnline__882:206675 Length = 247 Score = 140 bits (353), Expect = 3e-38 Identities = 90/245 (36%), Positives = 144/245 (58%), Gaps = 19/245 (7%) Query: 6 ERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAGKKNK 65 E AL+D++ ++ G V +IG +GSGKSTLL+ +N L KG I + I+A ++ Sbjct: 20 ELTALHDVSLDVQAGEKVVIIGPSGSGKSTLLRSINRLENVDKGSIIVDGKDIRA--EDS 77 Query: 66 DLKKLRKKVGIVFQFPEHQLF-EETVLKDISFGPMNFG-VKKEDAEQKAREMLQLVGLSE 123 D+ +R+ +G+VFQ LF +TVL++++ PM V +++AE +A ++L+ VG+S+ Sbjct: 78 DINVIRQDLGMVFQ--SFNLFPHKTVLQNLTMAPMRLRKVPRDEAESRALDLLKKVGISD 135 Query: 124 ELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQRGN 183 + + P LSGGQ +RVAIA LAM+P++++ DEPT+ LDP E++D+ L + G Sbjct: 136 KA-NVYPAMLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMIGEVLDVMVTLAKEG- 193 Query: 184 LTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLKGEEMAGWGLDLPETIKFQRH 243 +T + VTH M A AD +I M G I G+P+ F + PE + Q+ Sbjct: 194 MTMVCVTHEMGFAREVADRIIFMDHGQILEQGTPQHFF-----------EAPEHPRLQKF 242 Query: 244 LEAAL 248 L+ L Sbjct: 243 LQQIL 247 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 247 Length adjustment: 25 Effective length of query: 251 Effective length of database: 222 Effective search space: 55722 Effective search space used: 55722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory