GapMind for catabolism of small carbon sources

 

Aligments for a candidate for praB in Desulfovibrio vulgaris Hildenborough

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate 208845 DVU3319 proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase

Query= BRENDA::Q8BH00
         (487 letters)



>lcl|MicrobesOnline__882:208845 DVU3319 proline
           dehydrogenase/delta-1-pyrroline-5-carboxylate
           dehydrogenase
          Length = 1006

 Score =  221 bits (564), Expect = 7e-62
 Identities = 148/482 (30%), Positives = 241/482 (50%), Gaps = 19/482 (3%)

Query: 13  FIGGKFLPCNSYIDSYDPST-GEVYCKVPNSGKEEIEAAVEAAREAFPAWSSRSPQERSL 71
           +IGG+ +     I + +P+   EV   +  +G+ EI+ A+ AA++A   W   SP +R+ 
Sbjct: 515 YIGGRDVTTADLIPTTNPAKPAEVVASICQAGRPEIDDAIAAAKKAALTWRDTSPADRAA 574

Query: 72  VLNRLADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASSNLHHVSECTQM 131
            L R AD+  + + EL+  +  + GK    A   D+   +    ++A   L   +     
Sbjct: 575 YLRRAADICRKRIWELSAWQVVEVGKQWDQAYH-DVTEGIDFLEYYAREMLRLGAPRRMG 633

Query: 132 SHLGCMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSEMTSVTAWMFC 191
              G  ++    P GIA +I+PWN P  +     + AI  GN VI KPS ++S   +   
Sbjct: 634 RAPGEHNHLFYQPKGIAAVIAPWNFPFAIAIGMASAAIVTGNPVIFKPSSISSRIGYNLA 693

Query: 192 KLLDKAGVPPGVINIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAP------ 245
           ++  +AG+P GV N   G    +G+ LV HP++ LI FTGS     RI + +A       
Sbjct: 694 EVFREAGLPEGVFNYCPGRSSIMGDYLVEHPDISLICFTGSMEVGLRIQEKAAKVQPGQR 753

Query: 246 HCKKLSLELGGKNPAIIFEDANLEECIPATVRSSFANQGEICLCTSRIFVQRSIYSEFLK 305
            CK++  E+GGKN  II +DA+L+E +   + S+F  QG+ C   SR+ V  +IY  F++
Sbjct: 754 QCKRVIAEMGGKNATIIDDDADLDEAVLQVLYSAFGFQGQKCSACSRVIVLDAIYDRFIE 813

Query: 306 RFVEATRKWKVGVPSDPSANMGALISKAHLEKVRSYVLKAQTEGARILCGEGVDQLSLPL 365
           R V+A     +G   DPS  MG +      + V  Y+  A+ EG R+L    + +  LP 
Sbjct: 814 RLVKAASSIHIGPSEDPSNYMGPVADATLQKNVSDYIRIAEEEG-RVL----LKRTDLPA 868

Query: 366 RNQAGYFMLPTVITDIKDESRCMTEEIFGPVTCVVPFDSEEEVITRANSVRYGLAATVWS 425
               G ++  T++ DI+ E R   EEIFGPV  V+   + +E ++ AN  R+ L   V+S
Sbjct: 869 E---GCYVPLTIVGDIRPEHRIAQEEIFGPVLAVMRAATFDEALSIANGTRFALTGAVFS 925

Query: 426 KDVGRIHRVAKKLQSGLVWTNCWLIREL--NLPFGGMKSSGIG-REGAKDSYDFFTEIKT 482
           +    + +  ++ + G ++ N      L    PFGG   SG+G + G  D    F + + 
Sbjct: 926 RSPEHLDKARREFRVGNLYLNKGSTGALVERQPFGGFAMSGVGSKTGGPDYLLQFMDPRV 985

Query: 483 IT 484
           +T
Sbjct: 986 VT 987


Lambda     K      H
   0.319    0.134    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1001
Number of extensions: 36
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 487
Length of database: 1006
Length adjustment: 39
Effective length of query: 448
Effective length of database: 967
Effective search space:   433216
Effective search space used:   433216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory