Align ABC transporter permease (characterized, see rationale)
to candidate 209487 DVU0548 high-affinity branched-chain amino acid ABC transporter, permease protein
Query= uniprot:A0A165KC95 (309 letters) >MicrobesOnline__882:209487 Length = 302 Score = 271 bits (694), Expect = 1e-77 Identities = 143/297 (48%), Positives = 200/297 (67%), Gaps = 11/297 (3%) Query: 8 IINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPGAPGW 67 + GL GS+YALIALGYTMVYGII+LINFAHGEV MIGA T+ G++ + G P Sbjct: 10 LFGGLTRGSIYALIALGYTMVYGIIELINFAHGEVYMIGAFTALIVAGVL--GIYGFPEA 67 Query: 68 VILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMIIWKPNY 127 IL++A I+A + A F +EKVAY+PLR +PRL+PLI+AIGMSI LQ ++ ++ Sbjct: 68 GILIIAAIVAVIYCAAYGFTLEKVAYKPLRDAPRLSPLISAIGMSIFLQNYVILAQTSDF 127 Query: 128 KPYPTMLPSSPFEIGGAFITPTQ-ILILGVTAVALASLVYLVNHTNLGRAMRATAENPRV 186 P+P ++P A IT T +LI+ +A+ + L + +T +G+AMRATA+N ++ Sbjct: 128 VPFPRLVPDLAILEPIAHITGTSDVLIIVTSAITMVGLTLFIKYTRMGKAMRATAQNRKM 187 Query: 187 ASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAVFGGIGN 246 A L+G+ D VIS TFIIG+ LAAI G++ AS+ G +GF+ G+KAFTAAV GGIG+ Sbjct: 188 AMLLGIDADRVISLTFIIGSSLAAIGGVLIASHIGQVNFAIGFIAGIKAFTAAVLGGIGS 247 Query: 247 LAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGLLGE 303 + GA+ GG++LGL E+ +GY+ S Y D AF +L++IL RPSG+LG+ Sbjct: 248 IPGAMAGGLVLGLCESFATGYV--------SSDYEDALAFALLVLILIFRPSGILGK 296 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 302 Length adjustment: 27 Effective length of query: 282 Effective length of database: 275 Effective search space: 77550 Effective search space used: 77550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory