Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate 208681 DVU3161 ABC transporter, ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >MicrobesOnline__882:208681 Length = 349 Score = 298 bits (763), Expect = 1e-85 Identities = 164/345 (47%), Positives = 226/345 (65%), Gaps = 15/345 (4%) Query: 1 MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI 60 M+ I +DK+++ +G +A+ D++ ++E G+ +V +GPSGCGKST LR +AGLE V+SGRI Sbjct: 1 MSTIVLDKVSRHWGDVRAVDDVSFEVEQGDMLVLLGPSGCGKSTTLRLIAGLESVTSGRI 60 Query: 61 EIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARV 120 IGGRDVT + PA R LAMVFQSYAL+PH+TVR+N+ FG+ V R++R+ A + Sbjct: 61 LIGGRDVTNLPPAQRQLAMVFQSYALFPHLTVRDNILFGLVVRKVPAAERQKRLDRAVEI 120 Query: 121 LQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLH 180 L L L+RKPG+LSGGQ+QRVA+GRA+V +V L DEPLSNLDAKLR +MR E+ L Sbjct: 121 LGLGKLLERKPGELSGGQQQRVALGRALVAEAAVCLMDEPLSNLDAKLRQEMRREIRALQ 180 Query: 181 KQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMN 240 + LG TM+YVTHDQ EAM+MAD+I+++ GRI Q +P ++Y +P + F FIG+P MN Sbjct: 181 QTLGMTMVYVTHDQTEAMSMADRIILMQGGRIVQNATPTEMYSRPATAFAGSFIGTPPMN 240 Query: 241 VF---SSDVGLQ-------DISLDASA-AFVGCRPEHIEIVPDGDGHIAATVHVKERLGG 289 + +D G++ ++ A A +G RPEHI IV DG A V E LG Sbjct: 241 LVRLQGNDDGIRVAGSRSGRVTCHAGADCMLGIRPEHIRIVDDG---WRAVVESVEYLGS 297 Query: 290 ESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFDEA 334 S+L + G ++ V G +T VGA + L +H FD A Sbjct: 298 NSVLSCRV-GSEELSVVVHGVTDTVVGAEIYLHCPEEHVHIFDAA 341 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 349 Length adjustment: 29 Effective length of query: 309 Effective length of database: 320 Effective search space: 98880 Effective search space used: 98880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory