Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate 208681 DVU3161 ABC transporter, ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >MicrobesOnline__882:208681 Length = 349 Score = 278 bits (711), Expect = 2e-79 Identities = 161/362 (44%), Positives = 221/362 (61%), Gaps = 21/362 (5%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 M+ I +++H+ G + + + G+ +VLLGPSGCGKST LR+IAGLE ++ G Sbjct: 1 MSTIVLDKVSRHW-GDVRAVDDVSFEVEQGDMLVLLGPSGCGKSTTLRLIAGLESVTSGR 59 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 + IGG V +LP +R +AMVFQ+YAL+PH++V DNI FGL K PAAE +R+ Sbjct: 60 ILIGGRDVTNLPPAQRQLAMVFQSYALFPHLTVRDNILFGLVVRKVPAAERQKRLDRAVE 119 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 +L L LLERKP +SGGQQQR A+ RA++ +V L DEPLSNLDAKLR ++R +I+ L Sbjct: 120 ILGLGKLLERKPGELSGGQQQRVALGRALVAEAAVCLMDEPLSNLDAKLRQEMRREIRAL 179 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 Q L T VYVTHDQ EAM++ADR+ILMQ GRIVQ +P E+Y P FA FIGTP M Sbjct: 180 QQTLGMTMVYVTHDQTEAMSMADRIILMQGGRIVQNATPTEMYSRPATAFAGSFIGTPPM 239 Query: 241 NFLSGTVQRQDGQLFIETAHQRWALTGERFSRLR-HAMA-VKLAVRPDHVRIAGEREPAA 298 N + +Q D + + G R R+ HA A L +RP+H+RI + A Sbjct: 240 NLV--RLQGNDDGI---------RVAGSRSGRVTCHAGADCMLGIRPEHIRIVDDGWRAV 288 Query: 299 SLTCPVSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQHELHVFDVE 358 VE VE LG++++L+ R G + L+ +V GA + L + +H+FD Sbjct: 289 -------VESVEYLGSNSVLSCRVGSEELSVVVHGVTDTVVGAEIYLHCPEEHVHIFDAA 341 Query: 359 SG 360 +G Sbjct: 342 TG 343 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 349 Length adjustment: 30 Effective length of query: 376 Effective length of database: 319 Effective search space: 119944 Effective search space used: 119944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory