Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate 206645 3-oxoacyl-(acyl-carrier-protein) reductase
Query= BRENDA::Q8GR61 (262 letters) >MicrobesOnline__882:206645 Length = 259 Score = 131 bits (329), Expect = 2e-35 Identities = 84/255 (32%), Positives = 134/255 (52%), Gaps = 22/255 (8%) Query: 11 LVTGAGGNIGLATALRLAEEGTAIALLDMNR-EALEKAEASVREKGVEARSYVCDVTSEE 69 +VTG IG A A LA G + L +++ + E A +R+ G A ++ DV+ Sbjct: 21 IVTGGSRGIGKAVAETLARAGLQVFLTYVSKPDEAEAVAAGIRDAGGSATAFRLDVSDAA 80 Query: 70 AVIGTVDSVVRDFGKIDFLFNNAGY--QGAFAPVQDYPSDDFARVLTINVTGAFHVLKAV 127 AV S ++D ++D L NNAG G ++D +DF RVL +N+ GAF L+ Sbjct: 81 AVAAFFQSEIKDKVRLDVLVNNAGITKDGLIMRMKD---EDFERVLDVNLCGAFTCLREA 137 Query: 128 SRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISP 187 S+ M Q GRI+N S+ G G A Y +K +I LT++AA +LA N+ VNA++P Sbjct: 138 SKLMTRQRLGRIINITSVVGQMGNAGQANYCAAKAGLIGLTKSAAKELAARNVTVNAVAP 197 Query: 188 GYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGD 247 G++ + ++ A + P+ V + + ++P+RR G +I VAFL + Sbjct: 198 GFI--------ETDMTAGL--------PEEVRKAYVEAIPLRRLGSAQDIADAVAFLASE 241 Query: 248 DSSFMTGVNLPIAGG 262 +S++TG L + GG Sbjct: 242 RASYITGQVLAVNGG 256 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 259 Length adjustment: 25 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory