Align cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (EC 1.3.8.10) (characterized)
to candidate WP_011384980.1 AMB_RS13080 acyl-CoA dehydrogenase
Query= BRENDA::Q39QF5 (380 letters) >NCBI__GCF_000009985.1:WP_011384980.1 Length = 383 Score = 221 bits (563), Expect = 3e-62 Identities = 139/372 (37%), Positives = 199/372 (53%), Gaps = 9/372 (2%) Query: 12 LDMVRDVATREIAPRALELDEKSLFPEYARDLFAKLGLLNPLLPAAYGGTEMGVLTLALI 71 LD + + P + E P LGL +P YGG + + L Sbjct: 12 LDTLSRFVRERLVPNEERIAEDDALPAEIIAEMKDLGLFGLSIPEEYGGLGLTMEEEVLC 71 Query: 72 LEELGRVCASTALLLIAQTD---GMLPIIHGGSPELKERYLRRFAGESTLLTALAATEPA 128 E+G+ S A I T+ G II G+ E K++YL R A L+ + A TEP Sbjct: 72 AFEIGQT--SPAFRSIFGTNNGIGSQGIIIDGTEEQKQKYLPRLA-TGELIASFALTEPN 128 Query: 129 AGSDLLAMKTRAVRQGDKYVINGQKCFITNGSVADVIVVYAYTDPE-KGSKGISAFVVEK 187 AGSD +++T A + GD Y++NG K FITN A + + A TDP KG+ GISAF+VE Sbjct: 129 AGSDAASLRTTARKDGDHYIVNGTKRFITNAPEASIFTLMARTDPNNKGAGGISAFIVEA 188 Query: 188 GTPGLVYGRNESKMGMRGSINSELFFENMEVPAENIIGA-EGTGFANLMQTLSTNRVFCA 246 +PGL G+ + KMG +G+ ++ FE++ VPA NIIG EG GF M+ L R+ + Sbjct: 189 DSPGLSLGKIDKKMGQKGAHTCDVIFEDVRVPAANIIGGIEGQGFKTAMKVLDRGRLHIS 248 Query: 247 AQAVGIAQGALDIAVRHTQDRVQFGKPIAHLAPVQFMVADMATAVEASRLLTRKAAELLD 306 A VG+++ + +V++ +RVQFGKPI VQ M+AD T A+R + AA D Sbjct: 249 ATCVGVSERLIRDSVKYAAERVQFGKPIGEFQLVQAMLADSRTEAYAARCMVLDAARKKD 308 Query: 307 DGDKKAVLYGSMAKTMASDTAMRVTTDAVQVLGGSGYMKENGVERMMRDAKLTQIYTGTN 366 G + + K AS+ R+ AVQV GG+GY+ + G+ER RD +L +IY GT Sbjct: 309 QGINVST-EAACCKMFASEAVGRIADRAVQVHGGAGYISDYGIERFYRDVRLFRIYEGTT 367 Query: 367 QITRMVTGRALL 378 QI ++V R +L Sbjct: 368 QIQQLVIARNML 379 Lambda K H 0.319 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 383 Length adjustment: 30 Effective length of query: 350 Effective length of database: 353 Effective search space: 123550 Effective search space used: 123550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory