Align Iron-sulfur cluster-binding protein, putative (characterized, see rationale)
to candidate WP_011382617.1 AMB_RS00865 formate dehydrogenase subunit alpha
Query= uniprot:Q39TW6 (218 letters) >NCBI__GCF_000009985.1:WP_011382617.1 Length = 891 Score = 111 bits (278), Expect = 4e-29 Identities = 75/205 (36%), Positives = 100/205 (48%), Gaps = 27/205 (13%) Query: 4 INLQIDGKEVVATEGMTILDAAKSVGISIPTLCHHEK--LEPYGGCRICTVEVEVRGWPK 61 I +DG+EV A EG TI +K +G +IP LCH ++ EP G CR C VE+ +G Sbjct: 2 IRFTLDGQEVEAAEGETIWQVSKRLGTTIPHLCHTDRPGFEPEGNCRACVVEI--KGERA 59 Query: 62 LVAGCIYPVEKGLVVRTRNEKIDKIRKVLLEEMLA-HA---PDSEELKALAQEYGADRDR 117 L A C G+VV N + K R+++ E +LA HA PDS L A G R Sbjct: 60 LAASCRRRPTPGMVVEAANGRTAKARRMVFELLLADHASPDPDSAFL-GWAGALGVTASR 118 Query: 118 FE----------KHPSF------CIHCGLCVRYCAEIKKKNAVGFVDRGSNREIS--FIP 159 F HP+ CIHC LC+R C E++ + +G RG++ I+ F Sbjct: 119 FAPSAAPVRPDTSHPAMAVRLDACIHCTLCLRACREVQVNDVIGMSGRGADSRITFDFAQ 178 Query: 160 EIAAKECWDCKECFPLCPTSALQAA 184 + A C C EC CPT AL A Sbjct: 179 SMGASSCVGCGECVQACPTGALLPA 203 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 891 Length adjustment: 32 Effective length of query: 186 Effective length of database: 859 Effective search space: 159774 Effective search space used: 159774 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory