Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_011383725.1 AMB_RS06685 enoyl-CoA hydratase
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_000009985.1:WP_011383725.1 Length = 259 Score = 135 bits (340), Expect = 9e-37 Identities = 88/258 (34%), Positives = 137/258 (53%), Gaps = 6/258 (2%) Query: 6 IILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSFVAG 65 I L +E +A + +NRP MNALN + +A ++ D ++ ++I+ G+G K+F G Sbjct: 5 IQLVREGAIATVTLNRPDRMNALNLPMWRGLAEAFETISADRSIHVVILRGAGTKAFAPG 64 Query: 66 ADIAFMQNL--SAMEAREFGALGQKVFRLIEAMEKPVIAAVNGFALGGGCELAMCCDFRI 123 ADI L +A +A+ + + +K + A +PVIAA+ G +GGG ELA CCD R+ Sbjct: 65 ADIEEFDTLRANAEQAKAYDLVMRKALDTVRACPQPVIAAIWGPCVGGGLELACCCDIRL 124 Query: 124 AASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIGLVNKVV 183 +A + KFG P + + + ++ R+ GP A ++L +++ADEA LVN+VV Sbjct: 125 SAKSGKFGVPINKISVVMAYPELAQIRRVAGPAAALEILLEGRIMDADEAAAKRLVNRVV 184 Query: 184 QPEELLPEVKKIAGRILSKGQLAVRLSKA-AANEGMQTDIDRAMSIEADAFGLCFATQDQ 242 + + + EV A RI + LA R KA A T + A E D T+D Sbjct: 185 EDDAMDAEVAATAKRIAAGAPLANRWHKAFIARLDDPTPVSEA---ELDECYRFLDTKDY 241 Query: 243 KEGMTAFLEKRKANFISK 260 EG+ AF KRK F ++ Sbjct: 242 AEGLAAFRAKRKPVFTAE 259 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 259 Length adjustment: 24 Effective length of query: 236 Effective length of database: 235 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory