Align 4-hydroxybenzoyl-CoA reductase, γ subunit (EC 1.3.7.9) (characterized)
to candidate WP_011383893.1 AMB_RS07490 aldehyde oxidase
Query= metacyc::MONOMER-14378 (158 letters) >NCBI__GCF_000009985.1:WP_011383893.1 Length = 913 Score = 147 bits (372), Expect = 3e-40 Identities = 74/142 (52%), Positives = 90/142 (63%) Query: 6 TLSVNGRPREDAVAGNALLIDYLRDTLGLTGTKQGCDGGECGACTVLVDGQPRLACCTLA 65 TLS+NG V L LR+ LGL GTK GCD G+CGACTVL+DG+ +C Sbjct: 5 TLSINGTSHSLEVPPMRRLSKVLREDLGLRGTKVGCDAGDCGACTVLIDGESVCSCMIPV 64 Query: 66 HSVAGHSIETIEGLSHEGNLSRLQRAFHEHLGSQCGFCTPGMIMAAEALLRRNPQPSRDE 125 + G I T+EGLS L RLQRAF +QCG CTPGM+ AA ALLR P+PS DE Sbjct: 65 GRLTGREIITVEGLSEGAALGRLQRAFEHFGAAQCGICTPGMLNAATALLRSRPRPSEDE 124 Query: 126 IRAALAGNLCRCTGYVKIIESV 147 + A+ G LCRCTGY KI+++V Sbjct: 125 VLDAIGGVLCRCTGYRKIVQAV 146 Lambda K H 0.320 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 20 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 158 Length of database: 913 Length adjustment: 30 Effective length of query: 128 Effective length of database: 883 Effective search space: 113024 Effective search space used: 113024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory