GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ2 in Magnetospirillum magneticum AMB-1

Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_011384976.1 AMB_RS13060 acetyl-CoA C-acyltransferase

Query= SwissProt::P0C7L2
         (401 letters)



>lcl|NCBI__GCF_000009985.1:WP_011384976.1 AMB_RS13060 acetyl-CoA
           C-acyltransferase
          Length = 398

 Score =  434 bits (1117), Expect = e-126
 Identities = 229/401 (57%), Positives = 290/401 (72%), Gaps = 3/401 (0%)

Query: 1   MREAFICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQA 60
           M +A+I DG+R+PIGR+GG L+ VR+DDLAA  +R L+ R+     E ++DVILGC NQA
Sbjct: 1   MLDAYIYDGLRSPIGRHGGGLAPVRSDDLAAEVIRALVARSS-FKPEDVEDVILGCTNQA 59

Query: 61  GEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESM 120
           GED+RNVAR A LLAGLP  V+G T+NRLC SGL A+  AAR++  G+GDL +AGGVESM
Sbjct: 60  GEDSRNVARHAALLAGLPVEVAGQTVNRLCASGLAAVLDAARSVTCGEGDLYLAGGVESM 119

Query: 121 SRAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISRED 180
           +RAPFV+ K  SA+SR A +FDTTIG RF NP + + FG  SMPETA+N+A  L +SRE 
Sbjct: 120 TRAPFVLAKGDSAWSRDARIFDTTIGARFANPKVVKSFGGHSMPETADNIAHDLGLSREA 179

Query: 181 QDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKA 240
            D+FA  SQ + AKA++ G    EI P+ +  +KG  T +  DEH RP+T L  L  LK 
Sbjct: 180 SDAFAAASQAKYAKAKAEGFYEGEIHPITIAGRKG-DTIVAEDEHPRPQTDLAALTKLK- 237

Query: 241 PFRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPV 300
           P    GV+TAGNASG+NDGAAAL I S       G+ P ARIVA A AGV PR+MGLGPV
Sbjct: 238 PLFEGGVVTAGNASGINDGAAALFIGSRAAGEKAGIAPIARIVAGAAAGVPPRVMGLGPV 297

Query: 301 PATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLG 360
           PA  + L RA LS+ D+D+IE+NEAFA Q LG + +LG+  D   +NPNGGAIA+GHPLG
Sbjct: 298 PAITKALARAKLSLKDLDLIEINEAFAVQVLGCVTQLGVAADDSRLNPNGGAIAIGHPLG 357

Query: 361 MSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV 401
            SGARLAL A+ +L R  GR+A+ ++CIGVG G+A ++ERV
Sbjct: 358 CSGARLALTAARQLQRTGGRHAVVSLCIGVGHGLAAVIERV 398


Lambda     K      H
   0.319    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 524
Number of extensions: 14
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 398
Length adjustment: 31
Effective length of query: 370
Effective length of database: 367
Effective search space:   135790
Effective search space used:   135790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory