GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ2 in Magnetospirillum magneticum AMB-1

Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate WP_011385133.1 AMB_RS13850 3-oxoadipyl-CoA thiolase

Query= metacyc::MONOMER-15952
         (401 letters)



>lcl|NCBI__GCF_000009985.1:WP_011385133.1 AMB_RS13850
           3-oxoadipyl-CoA thiolase
          Length = 400

 Score =  567 bits (1460), Expect = e-166
 Identities = 291/401 (72%), Positives = 329/401 (82%), Gaps = 1/401 (0%)

Query: 1   MNEALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQA 60
           M EALI D  RTPIGRYAG+LA VR DDL A P+KAL+ARH  LDWS VD+V YGCANQA
Sbjct: 1   MTEALICDYTRTPIGRYAGSLAGVRTDDLAAHPIKALMARHAGLDWSRVDEVAYGCANQA 60

Query: 61  GEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESM 120
           GEDNRNVARMA LLAGLP S+ GTTLNRLCGSG+DAVG AARA+  GEA LM+AGGVESM
Sbjct: 61  GEDNRNVARMALLLAGLPHSIGGTTLNRLCGSGMDAVGYAARAVMTGEAELMIAGGVESM 120

Query: 121 SRAPFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRAD 180
           SRAPFVM K++ AF R A ++DTTIGWRFVN LM++ +G DSMPETAENVA QFNISR D
Sbjct: 121 SRAPFVMNKADSAFSRDARLYDTTIGWRFVNALMEKAYGTDSMPETAENVAEQFNISRED 180

Query: 181 QDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGT 240
           QDAFA RSQ KA+AA  NGR A+EI  V +  RKG   +V HDEHPR +TT+E LAKL  
Sbjct: 181 QDAFAARSQAKASAAQKNGRFAQEISPVTLPARKGDPVVVSHDEHPR-ETTVEALAKLKA 239

Query: 241 PFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGPV 300
           PFR GGS+TAGNASGVNDGA ALL+AS  AA+ HGL   AR++GMATAGVEPRIMGIGPV
Sbjct: 240 PFRAGGSITAGNASGVNDGAAALLIASPAAAKAHGLTPIARILGMATAGVEPRIMGIGPV 299

Query: 301 PATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPLG 360
           PAT+K+L   GL +AD+DV+E NEAFAAQ LA  R+LGLADDD+RVNPNGGAIALGHPLG
Sbjct: 300 PATQKLLARLGLTMADLDVMEFNEAFAAQALACTRQLGLADDDQRVNPNGGAIALGHPLG 359

Query: 361 MSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401
           MSGAR+V TA  +L +  GR AL TMCIGVGQGIA+ IER+
Sbjct: 360 MSGARIVGTAALQLAQTGGRRALSTMCIGVGQGIAMAIERV 400


Lambda     K      H
   0.319    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 552
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 400
Length adjustment: 31
Effective length of query: 370
Effective length of database: 369
Effective search space:   136530
Effective search space used:   136530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate WP_011385133.1 AMB_RS13850 (3-oxoadipyl-CoA thiolase)
to HMM TIGR02430 (pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02430.hmm
# target sequence database:        /tmp/gapView.9917.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02430  [M=400]
Accession:   TIGR02430
Description: pcaF: 3-oxoadipyl-CoA thiolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
     8e-212  689.4  12.7     9e-212  689.2  12.7    1.0  1  lcl|NCBI__GCF_000009985.1:WP_011385133.1  AMB_RS13850 3-oxoadipyl-CoA thio


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000009985.1:WP_011385133.1  AMB_RS13850 3-oxoadipyl-CoA thiolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  689.2  12.7    9e-212    9e-212       2     400 .]       3     400 .]       2     400 .] 1.00

  Alignments for each domain:
  == domain 1  score: 689.2 bits;  conditional E-value: 9e-212
                                 TIGR02430   2 evyivdairtpiGrygGslssvraddlaavplkallarnpsldaaaiddvilGcanqaGednrnvarma 70 
                                               e+ i+d  rtpiGry+Gsl+ vr+ddlaa p+kal+ar++ ld++ +d+v +GcanqaGednrnvarma
  lcl|NCBI__GCF_000009985.1:WP_011385133.1   3 EALICDYTRTPIGRYAGSLAGVRTDDLAAHPIKALMARHAGLDWSRVDEVAYGCANQAGEDNRNVARMA 71 
                                               789****************************************************************** PP

                                 TIGR02430  71 allaGlpvsvpgttvnrlcgsgldalglaaraikaGeadlviaGGvesmsrapfvlGkadsafsrsakl 139
                                               +llaGlp+s+ gtt+nrlcgsg+da+g+aara+ +Gea+l+iaGGvesmsrapfv+ kadsafsr+a+l
  lcl|NCBI__GCF_000009985.1:WP_011385133.1  72 LLLAGLPHSIGGTTLNRLCGSGMDAVGYAARAVMTGEAELMIAGGVESMSRAPFVMNKADSAFSRDARL 140
                                               ********************************************************************* PP

                                 TIGR02430 140 edttiGwrfvnpklkalyGvdsmpetaenvaeefgvsredqdafalrsqqrtaaaqakGffaeeivpve 208
                                                dttiGwrfvn  +++ yG+dsmpetaenvae+f++sredqdafa rsq++++aaq++G fa+ei pv+
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 141 YDTTIGWRFVNALMEKAYGTDSMPETAENVAEQFNISREDQDAFAARSQAKASAAQKNGRFAQEISPVT 209
                                               ********************************************************************* PP

                                 TIGR02430 209 ikqkkGeetvvdkdehlraettlealaklkavvredgtvtaGnasGvndGaaalllaseeavkrhgltp 277
                                               ++ +kG+++vv++deh+r ett+ealaklka++r++g++taGnasGvndGaaall+as  a+k+hgltp
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 210 LPARKGDPVVVSHDEHPR-ETTVEALAKLKAPFRAGGSITAGNASGVNDGAAALLIASPAAAKAHGLTP 277
                                               ******************.************************************************** PP

                                 TIGR02430 278 rarilaaasaGveprvmGlgpvpavkkllaraglsledldvielneafaaqalavlrelgladddarvn 346
                                                aril++a+aGvepr+mG+gpvpa++kllar+gl+++dldv+e+neafaaqala++r+lgladdd+rvn
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 278 IARILGMATAGVEPRIMGIGPVPATQKLLARLGLTMADLDVMEFNEAFAAQALACTRQLGLADDDQRVN 346
                                               ********************************************************************* PP

                                 TIGR02430 347 pnGGaialGhplGasGarlvltalkqleksggryalatlciGvGqGialvierv 400
                                               pnGGaialGhplG+sGar+v ta  ql+++ggr+al+t+ciGvGqGia++ierv
  lcl|NCBI__GCF_000009985.1:WP_011385133.1 347 PNGGAIALGHPLGMSGARIVGTAALQLAQTGGRRALSTMCIGVGQGIAMAIERV 400
                                               *****************************************************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (400 nodes)
Target sequences:                          1  (400 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.59
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory