GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pobA in Magnetospirillum magneticum AMB-1

Align p-hydroxybenzoate hydroxylase; PHBH; 4-hydroxybenzoate 3-monooxygenase; EC 1.14.13.2 (characterized)
to candidate WP_011382706.1 AMB_RS01315 4-hydroxybenzoate 3-monooxygenase

Query= SwissProt::P20586
         (394 letters)



>lcl|NCBI__GCF_000009985.1:WP_011382706.1 AMB_RS01315
           4-hydroxybenzoate 3-monooxygenase
          Length = 391

 Score =  542 bits (1397), Expect = e-159
 Identities = 271/392 (69%), Positives = 312/392 (79%), Gaps = 1/392 (0%)

Query: 1   MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAG 60
           M+ QVAIIGAGPSGL+LGQLL KAGID +ILE QTPDYVLGRIRAGVLEQ  VDLL EAG
Sbjct: 1   MRVQVAIIGAGPSGLILGQLLAKAGIDALILEAQTPDYVLGRIRAGVLEQVCVDLLDEAG 60

Query: 61  VDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREACGATT 120
           V  R+  +GL H+G+E+   G R RIDL  L+GGK VTVYGQTE+TRDLMEAR      T
Sbjct: 61  VGERLHAEGLPHQGIELLVDGTRHRIDLAGLTGGKQVTVYGQTELTRDLMEARTRAALKT 120

Query: 121 VYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERV 180
           VY+A EV + D   + P V++ +DG R  ++CD+IAGCDG+HG+ R S+P + L+ FERV
Sbjct: 121 VYEAKEVMVSDFDTDHPRVSYLKDGVRHEVECDFIAGCDGYHGVCRASVPKDALRTFERV 180

Query: 181 YPFGWLGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFW 240
           YPFGWLGLL+DTPPV+HELIYA   RGFALCSQRS TRSRYY+QVPLSEKVEDWSDERFW
Sbjct: 181 YPFGWLGLLSDTPPVNHELIYAKSERGFALCSQRSLTRSRYYLQVPLSEKVEDWSDERFW 240

Query: 241 TELKARLPSEVAEKLVTGPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLN 300
            EL+ RL     + LVTGPSLEKSIAPLRSFV EPM+ GRLFLAGDAAHIVPPTGAKGLN
Sbjct: 241 GELRQRLDGRANDALVTGPSLEKSIAPLRSFVAEPMRFGRLFLAGDAAHIVPPTGAKGLN 300

Query: 301 LAASDVSTLYRLLLKAYREGRGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFS 360
           LAASDV TL   L++ Y  G  E ++RYS  CLRRIWKAERFSWWMT++LHRFPDT  F 
Sbjct: 301 LAASDVRTLGHALIEFY-GGSLEGIDRYSERCLRRIWKAERFSWWMTNLLHRFPDTPPFE 359

Query: 361 QRIQQTELEYYLGSEAGLATIAENYVGLPYEE 392
           QR  + EL+Y + S AG  TIAENYVGLP+E+
Sbjct: 360 QRALEAELDYVVHSLAGRTTIAENYVGLPFED 391


Lambda     K      H
   0.321    0.138    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 559
Number of extensions: 21
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 394
Length of database: 391
Length adjustment: 31
Effective length of query: 363
Effective length of database: 360
Effective search space:   130680
Effective search space used:   130680
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate WP_011382706.1 AMB_RS01315 (4-hydroxybenzoate 3-monooxygenase)
to HMM TIGR02360 (pobA: 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02360.hmm
# target sequence database:        /tmp/gapView.2840.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02360  [M=390]
Accession:   TIGR02360
Description: pbenz_hydroxyl: 4-hydroxybenzoate 3-monooxygenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
     6e-206  669.7   0.0   6.7e-206  669.5   0.0    1.0  1  lcl|NCBI__GCF_000009985.1:WP_011382706.1  AMB_RS01315 4-hydroxybenzoate 3-


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000009985.1:WP_011382706.1  AMB_RS01315 4-hydroxybenzoate 3-monooxygenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  669.5   0.0  6.7e-206  6.7e-206       1     390 []       1     389 [.       1     389 [. 1.00

  Alignments for each domain:
  == domain 1  score: 669.5 bits;  conditional E-value: 6.7e-206
                                 TIGR02360   1 mktqvaiigaGpsGlllgqllhkaGidavilerksrdyvlgriraGvleqgtvdlleeagvderldreg 69 
                                               m++qvaiigaGpsGl+lgqll kaGida+ile +++dyvlgriraGvleq+ vdll+eagv+erl++eg
  lcl|NCBI__GCF_000009985.1:WP_011382706.1   1 MRVQVAIIGAGPSGLILGQLLAKAGIDALILEAQTPDYVLGRIRAGVLEQVCVDLLDEAGVGERLHAEG 69 
                                               9******************************************************************** PP

                                 TIGR02360  70 lvheGveiafegekvrvdlkkltggksvlvyGqtevtrdlyeareaaglktvyeadevrlhdlesdrpk 138
                                               l+h+G+e+ ++g+++r+dl+ ltggk+v+vyGqte+trdl+ear +a lktvyea+ev + d+++d+p+
  lcl|NCBI__GCF_000009985.1:WP_011382706.1  70 LPHQGIELLVDGTRHRIDLAGLTGGKQVTVYGQTELTRDLMEARTRAALKTVYEAKEVMVSDFDTDHPR 138
                                               ********************************************************************* PP

                                 TIGR02360 139 vtfekdgeekrldcdfiaGcdGfhGvsrksipaeklkefekvypfGwlGilsetppvsdeliysnserG 207
                                               v++ kdg +++++cdfiaGcdG+hGv+r+s+p+++l++fe+vypfGwlG+ls+tppv++eliy++serG
  lcl|NCBI__GCF_000009985.1:WP_011382706.1 139 VSYLKDGVRHEVECDFIAGCDGYHGVCRASVPKDALRTFERVYPFGWLGLLSDTPPVNHELIYAKSERG 207
                                               ********************************************************************* PP

                                 TIGR02360 208 falcslrsetrsryyvqvsltdkvedwsddrfweelkrrldeeaaeklvtgpsieksiaplrsfvaepm 276
                                               falcs+rs trsryy+qv+l++kvedwsd+rfw el++rld +a + lvtgps+eksiaplrsfvaepm
  lcl|NCBI__GCF_000009985.1:WP_011382706.1 208 FALCSQRSLTRSRYYLQVPLSEKVEDWSDERFWGELRQRLDGRANDALVTGPSLEKSIAPLRSFVAEPM 276
                                               ********************************************************************* PP

                                 TIGR02360 277 ryGrlflaGdaahivpptGakGlnlaasdvaylyealleaykekdsaglerysakalarvwkaerfsww 345
                                               r+GrlflaGdaahivpptGakGlnlaasdv +l +al+e+y  ++ +g++rys+++l+r+wkaerfsww
  lcl|NCBI__GCF_000009985.1:WP_011382706.1 277 RFGRLFLAGDAAHIVPPTGAKGLNLAASDVRTLGHALIEFYG-GSLEGIDRYSERCLRRIWKAERFSWW 344
                                               ****************************************96.7899********************** PP

                                 TIGR02360 346 ltsllhrfpdedefdkkiqqaeleylleseaaqktlaenyvGlpy 390
                                               +t+llhrfpd+  f+++  +ael+y+++s a+++t+aenyvGlp+
  lcl|NCBI__GCF_000009985.1:WP_011382706.1 345 MTNLLHRFPDTPPFEQRALEAELDYVVHSLAGRTTIAENYVGLPF 389
                                               ********************************************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (390 nodes)
Target sequences:                          1  (391 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.78
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory