Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate WP_043743999.1 AMB_RS09135 branched-chain amino acid ABC transporter permease
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >NCBI__GCF_000009985.1:WP_043743999.1 Length = 304 Score = 436 bits (1122), Expect = e-127 Identities = 218/304 (71%), Positives = 262/304 (86%), Gaps = 3/304 (0%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSL 60 MEYFLQQLINGL+LGAIYGL+A+GYTMVYG++GMINFAHG IYM+GAF++LITFL ++ Sbjct: 1 MEYFLQQLINGLTLGAIYGLVALGYTMVYGVLGMINFAHGTIYMVGAFISLITFLVATTV 60 Query: 61 GITWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQI 120 T VPLAL++ LVA+M TA++GWT ER+AYRPLRS+PRLAPLISAIG+SI LQN+V Sbjct: 61 LGTSVPLALVLTLVAAMALTALWGWTAERVAYRPLRSAPRLAPLISAIGVSIMLQNFVAQ 120 Query: 121 LQGARSKPLQPILPGNLTLMDGA---VSVSYVRLATIVITIALMYGFTQLITRTSLGRAQ 177 QGAR+KPL P+ G +TLMD VS+S++++ + +T+ALM FT +ITRT+LGRAQ Sbjct: 121 AQGARAKPLPPVFRGGITLMDSGDFVVSLSWMQMVIMALTLALMAVFTWVITRTALGRAQ 180 Query: 178 RACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFT 237 RACEQD KMA LLG++VDRVIS TFV+GA LA VAGMMV L YGVIDFYIGFLAG+KAFT Sbjct: 181 RACEQDMKMASLLGIDVDRVISTTFVIGAGLAGVAGMMVTLYYGVIDFYIGFLAGIKAFT 240 Query: 238 AAVLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLLGRPE 297 AAVLGGIGSLPGAMLGG++IGLIEAFWS Y E+KDVATF+ILV VL+FRPTGLLGRP+ Sbjct: 241 AAVLGGIGSLPGAMLGGLLIGLIEAFWSAYFSIEYKDVATFSILVAVLVFRPTGLLGRPD 300 Query: 298 IEKV 301 +EK+ Sbjct: 301 VEKI 304 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 304 Length adjustment: 27 Effective length of query: 274 Effective length of database: 277 Effective search space: 75898 Effective search space used: 75898 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory