Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_083763604.1 AMB_RS09125 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_000009985.1:WP_083763604.1 Length = 257 Score = 360 bits (923), Expect = e-104 Identities = 186/256 (72%), Positives = 209/256 (81%), Gaps = 1/256 (0%) Query: 19 MRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTLRHADGKEF 78 MRFGGL AVND+SFSA EITA+IGPNGAGKTTLFNCITGFY P VGR+TL H G Sbjct: 1 MRFGGLFAVNDLSFSAAPKEITAVIGPNGAGKTTLFNCITGFYKPQVGRMTLDHPSGP-M 59 Query: 79 LLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIAGLLGLPSY 138 LLER+ + IS KA VARTFQNIRLF MSVLENLIVAQH L+RAS FS+AGLLGL Y Sbjct: 60 LLERLDDFAISAKAGVARTFQNIRLFARMSVLENLIVAQHTTLMRASAFSLAGLLGLSRY 119 Query: 139 TRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVMLCLDEPAAG 198 R E AV+ A++WLD+V L AD EAG+LPYG QRRLEIARAMCT P++LCLDEPAAG Sbjct: 120 ARAEARAVERARHWLDKVGLTSLADEEAGSLPYGHQRRLEIARAMCTGPLLLCLDEPAAG 179 Query: 199 LNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKISDGDPAFVKN 258 LNPRES EL LL IRDE+ IG+LLIEHDMSVVM ISDH+VVLDYG+KI++G PA +K Sbjct: 180 LNPRESAELNRLLLDIRDENGIGLLLIEHDMSVVMEISDHIVVLDYGKKIAEGAPAAIKA 239 Query: 259 DPAVIRAYLGEEEDEE 274 DPAVIRAYLGE ++EE Sbjct: 240 DPAVIRAYLGEPDEEE 255 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 257 Length adjustment: 25 Effective length of query: 269 Effective length of database: 232 Effective search space: 62408 Effective search space used: 62408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory