Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate WP_011383782.1 AMB_RS06945 phosphate ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >NCBI__GCF_000009985.1:WP_011383782.1 Length = 259 Score = 139 bits (351), Expect = 4e-38 Identities = 87/247 (35%), Positives = 135/247 (54%), Gaps = 14/247 (5%) Query: 15 IQMQGVNKWYGQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEE-----HQQG 69 I +G+N YG+ L DI+L++ GE L GPSG GKST +RC+NR+ + G Sbjct: 12 ISARGLNVHYGEKQALHDIDLDIPAGEVTALIGPSGCGKSTFLRCINRMNDMVDGAKVTG 71 Query: 70 RIVVDGVELTNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAE-- 127 + +DG ++ + + +R VGMVFQ N FP +I N P + + + +AE Sbjct: 72 SLTLDGSDVYDRSLDVVQLRARVGMVFQKPNPFPK-SIYDNVAYGPR-IHGLARDQAELD 129 Query: 128 EIAMHYLERVRIPEQAHKYPGQ----LSGGQQQRVAIARALCMKPKIMLFDEPTSALDPE 183 EI M+ LE+ + + + LSGGQQQR+ IARA+ + P+++L DEP SALDP Sbjct: 130 EIVMNSLEKAGLLAEVESRLSESGTGLSGGQQQRLCIARAIAVAPEVILMDEPCSALDPI 189 Query: 184 MVKEVLDTMIGLAEDGMTMLCVTHEMGFARTVANRVIFMDKGEIVEQAAPNDFFDNPQND 243 +V + +I D T++ VTH M A V+ R F G+++E + F NP+ Sbjct: 190 ATAKV-EELIDELRDNYTIVIVTHSMQQAARVSQRTAFFHLGKLIEVGGTEEIFTNPKEP 248 Query: 244 RTKLFLS 250 T+ +++ Sbjct: 249 LTQGYIT 255 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 259 Length adjustment: 24 Effective length of query: 230 Effective length of database: 235 Effective search space: 54050 Effective search space used: 54050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory