Align D-alanine dehydrogenase (EC 1.4.99.-) (characterized)
to candidate WP_011385177.1 AMB_RS14080 D-amino-acid dehydrogenase
Query= reanno::azobra:AZOBR_RS08020 (436 letters) >NCBI__GCF_000009985.1:WP_011385177.1 Length = 422 Score = 417 bits (1073), Expect = e-121 Identities = 205/417 (49%), Positives = 283/417 (67%), Gaps = 1/417 (0%) Query: 1 MRVIVLGSGVIGVSTAYFLAKAGHEVTVVDRQPGPALETSYANAGEVSPGYSAPWAAPGL 60 M+V+V+G+GV+G ++A++LAKAGHEVTVVDR+ G LETS+AN G++SP ++ PWA P + Sbjct: 1 MKVVVIGAGVVGTASAWYLAKAGHEVTVVDRREGAGLETSFANGGQISPCHAEPWANPSV 60 Query: 61 MAKAVKWMLMKHSPLVIR-PKMDPAMWSWCLKLLANANERSYEINKGRMVRLAEYSRDCL 119 + K +KW+ + +PL+ R + DPA+W+W L+ LAN + EIN R +R+A YSR CL Sbjct: 61 LPKVLKWLGREDAPLLFRWNRWDPALWAWGLRFLANCSRSRAEINTERTLRVALYSRACL 120 Query: 120 RVLRDETGIRYDERAKGTLQVFRTQKQVDAAATDMAVLDRFKVPYSLLDVEGCAAVEPAL 179 LR ETGI YD++ +G L V+R + + A V+ R + C A+EPAL Sbjct: 121 GELRAETGIAYDQQVRGILHVYRDGAEFEHACRAAEVMIRHGLRRLPRTPAECTAIEPAL 180 Query: 180 RLVKEKIVGGLLLPGDETGDCFRFTNALAAMATELGVEFRYNTGIRKLESDGRRVTGVVT 239 V+ ++ GG+ P DE+GD +FT LAA+A GVEFR+N I+ L +DG RV G+ T Sbjct: 181 GAVQGELAGGIYTPDDESGDAHKFTRELAALAAAKGVEFRWNVPIQSLLADGDRVAGLAT 240 Query: 240 DAGTLTADSYVVAMGSYSPTLVKPFGLDLPVYPVKGYSLTLPIVDAAGAPESTVMDETHK 299 GT+ A+SYV+A G SP L +P GL LP+ P KGYS+T+P+ + AGAP ++ D+ HK Sbjct: 241 SDGTIRAESYVLAAGCDSPLLARPLGLRLPIIPAKGYSVTVPVDNHAGAPLVSITDDEHK 300 Query: 300 IAVTRLGDRIRVGGTAELTGFDLTLRPGRRGPLDHVVSDLFPTGGDLSKAEFWTGLRPNT 359 + +RLGDR+R GTAE+ G+D P R + LFP GGD +AE W GLRP T Sbjct: 301 MVYSRLGDRLRAAGTAEMAGYDRMPNPVRNRLILDNARRLFPDGGDFDRAEPWAGLRPVT 360 Query: 360 PDGTPIVGPTPVRNLFLNTGHGTLGWTMAAGSGRVVADVVGGRQTEIDMDGLTVARY 416 PD P++G TP+RNL+LNTGHGTLGWTM+ GSGR+VAD+V GR + I MDGL + R+ Sbjct: 361 PDSVPLLGATPLRNLWLNTGHGTLGWTMSCGSGRIVADLVSGRPSAISMDGLGIDRF 417 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 422 Length adjustment: 32 Effective length of query: 404 Effective length of database: 390 Effective search space: 157560 Effective search space used: 157560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory