Align D-lactate transporter, permease component 2 (characterized)
to candidate WP_011385250.1 AMB_RS14465 branched-chain amino acid ABC transporter permease
Query= reanno::Phaeo:GFF1250 (340 letters) >NCBI__GCF_000009985.1:WP_011385250.1 Length = 286 Score = 194 bits (493), Expect = 2e-54 Identities = 114/327 (34%), Positives = 171/327 (52%), Gaps = 49/327 (14%) Query: 5 LLQILNGLDKGSAYALIALGLTLIFGTLGVVNFAHGALFMIGAFCAVTVQRVLSLSFETV 64 L+Q+LNG+ G L+A GLTLIFG +G++N AHGA +M+GA+ A Sbjct: 7 LIQVLNGVQYGLLLFLVASGLTLIFGIMGIINLAHGAFYMLGAYLAY------------- 53 Query: 65 DETQKDFLGNPLKVKTPYVESWFGPEVGGAIIDWAVPLAILFAIPIMIGVGYVMERGLIK 124 W G ++ A+L ++PI +GY +E L++ Sbjct: 54 ---------------------WLARTTG------SLGAAVLLSLPIAAAIGYGIEALLVR 86 Query: 125 HFYKRPHADQILVTFGLAIVLQEVVKYFYGANPIQTPAPDALNGVVNLGSIIGMDIVYPV 184 Y+R H DQ+L+T+GL ++ E + +GA+ P ALN + L + YPV Sbjct: 87 TLYRRDHLDQVLLTYGLILIFNEATRMIWGADVHGVAVPAALNWSIRLTDTLS----YPV 142 Query: 185 WRVVYFFFAVVIIGGIFSFLQFTTFGMVVRAGMADRETVGLLGINIDRRFTIMFGIAAAV 244 +R++ V+ G++ + T FGM VRAG ++R+ V LGIN+ F ++F + AA+ Sbjct: 143 YRLMLSGVCAVLAVGMYLVITRTRFGMWVRAGASNRDMVAALGINVKLLFGVVFALGAAL 202 Query: 245 AGLAGVMYTPINSPNYHMGMDFLVLSFVVVVVGGMGSLPGAVLAGFLLGVLESFASMNEI 304 AGLAG + TPI S MG L+L FVVVV+GG+GS+ GA L L+G+ ++F Sbjct: 203 AGLAGAISTPITSVAPGMGDSVLILCFVVVVIGGVGSIKGAFLGAMLIGLADTFG----- 257 Query: 305 KSLIPGIDQIIIYVVAIIILLTRPRGL 331 K P +Y V +LL +PRGL Sbjct: 258 KVFAPDFASFTVYGVMAAVLLWKPRGL 284 Lambda K H 0.329 0.147 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 340 Length of database: 286 Length adjustment: 27 Effective length of query: 313 Effective length of database: 259 Effective search space: 81067 Effective search space used: 81067 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory