Align actP-like component of L-lactate and L-malate uptake system (characterized)
to candidate WP_011386681.1 AMB_RS21920 cation acetate symporter
Query= reanno::PV4:5209923 (572 letters) >NCBI__GCF_000009985.1:WP_011386681.1 Length = 554 Score = 167 bits (422), Expect = 1e-45 Identities = 141/492 (28%), Positives = 220/492 (44%), Gaps = 63/492 (12%) Query: 9 LIVGFTFALYIGIAIWS--RAGSTKEFYVAGGGVHPVMNGMATAADWMSAASFISLAGIV 66 + VGF L +GI W+ R S +FY AGGG+ NG+A A D+MSAASF+ + ++ Sbjct: 43 MFVGFVL-LTLGITWWASKRTKSAADFYTAGGGITGFQNGLAIAGDFMSAASFLGVTALL 101 Query: 67 SFVGYDGSVYLMGWTGGYVLLALCMAPYLRKFGKFTVPDFIGDRYYSQAARTVAVVCAIF 126 G DG VY +G G+ L+ +A LR GK+T D + R RT A ++ Sbjct: 102 YGTGLDGMVYAVGVVVGWPLMLFLIAEPLRNLGKYTFADVVAYRLAKVPVRTYAAFSSLT 161 Query: 127 ICFTYIAGQMRGVGVVFSRFLEVEVDTGVYIGMAVVFFYAVLGGMKGITYTQVAQYCVLI 186 + Y+ QM G G + ++ +++ ++ Y GGM T+ Q+ + +L+ Sbjct: 162 VVVFYLIAQMVGAGQLIKLLFGMDYLYALFLVGGLMMIYVTFGGMAATTWVQIIKAVLLL 221 Query: 187 FAFMVPAIFISVMMTGHILPQLGFGAELVDAAGNNTGVYLLEKLDGLSAQLGFSQYTEGS 246 + M G +L + GF E + A V + +S L F Sbjct: 222 SG--------ATFMAGAVLSRFGFSPEAMFA----KAVQVKGSNAIMSPGLLF------- 262 Query: 247 KGMIDVFFITGALMFGTAGLPHVIVRFFTVPKVKDARVSAGWALVFIAIMYTTIPALAAF 306 K ID + AL FGTAGLPH+++RFFTVP K+AR S +A FI Y LA Sbjct: 263 KDPIDTISLAMALAFGTAGLPHILMRFFTVPDAKEARKSVFYATAFIGFFY----VLAVV 318 Query: 307 SRVNMIETINGPESTGVAYETAPDWIKNWEKTGLIKWDDKNNDGKIYYAKGETNEMKIDR 366 + I + T P ++ DGK KG N + Sbjct: 319 IGIGAIALV----------ATDPTYLA---------------DGKA--LKGGGNMAAV-- 349 Query: 367 DIMVLATPEIANLPAWVIALVAAGGLAAALSTSAGLLLVISTSVSHDLLKKNF-MPDISD 425 LA +L + ++A A L+ AGL L ++++SHDL F + Sbjct: 350 ---WLAHAVGGDL---FLGFISAVAFATILAVVAGLTLAGASAISHDLYANVFARGHAKE 403 Query: 426 KQELLYARIAA-ALGIVMAGYFGINPPGFVAAVVAIAFGLAASSLFPAIIMGIFSRTMNK 484 + EL +R+A+ ALG++ + +A + + +AAS+ FP +++ + + Sbjct: 404 ETELRISRLASLALGVIAIILGMLFEKQNIAYLAGLTLAIAASANFPLLLLSMLWPGLTS 463 Query: 485 EGAIAGMVIGLL 496 GAI G V GL+ Sbjct: 464 RGAILGGVAGLV 475 Lambda K H 0.326 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 880 Number of extensions: 54 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 572 Length of database: 554 Length adjustment: 36 Effective length of query: 536 Effective length of database: 518 Effective search space: 277648 Effective search space used: 277648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory