Align phosphotransacetylase (EC 2.3.1.8) (characterized)
to candidate WP_011382736.1 AMB_RS01465 NADP-dependent malic enzyme
Query= metacyc::PTACLOS-MONOMER (333 letters) >NCBI__GCF_000009985.1:WP_011382736.1 Length = 766 Score = 160 bits (404), Expect = 1e-43 Identities = 102/331 (30%), Positives = 174/331 (52%), Gaps = 13/331 (3%) Query: 4 IESIWECAKQDKKRIILAEGEEKRNLIAADKIIKEGLAELVLVGDENKIKEKASELNLDI 63 +++I + K + KR++ AEGEE++ + AA GL +L+G E++I+E + L Sbjct: 446 MQTITDVVKANPKRVVFAEGEEEKQIRAAVAFANAGLGHPILLGREDRIRETMKNIGLPA 505 Query: 64 SKA-EIMDPETSLKTETYARDFYELRKHKGMTIEKSEKMV-RDPLYFATMALKDGYVDGM 121 +++ +I++ S +T+ Y Y + +G +++V ++ F ++ ++ G D M Sbjct: 506 AESLDIINSRISPRTKAYTDMLYARLQRRGALYRDVQRLVNQERNIFGSLMVQSGDADAM 565 Query: 122 VSGAVHTTGDLLRPGLQIIKTAPGVKIVSGFFVMIIPDCDYGEEGLLLF-ADCAVNPNPT 180 V+G ++I PG +++ G V ++ +G L+F AD V PT Sbjct: 566 VTGLTRNYWQAFEEIKKVIDPTPG-ELMFGMTVFVV-------KGKLVFVADTTVMETPT 617 Query: 181 SDELADIAITTAETARKLCNVEPKVAMLSFSTMGSAKGEMVDKVKNAVEITKKFRPDLAI 240 +LADIA+ TA AR++ + EP+VAM+S+S G+ E D+V+ AV + + D Sbjct: 618 PQQLADIAVQTAHKARQMGH-EPRVAMISYSNFGNPSSERSDRVREAVGLLDARKVDFVY 676 Query: 241 DGELQLDAAIDSEVAALKAPSSNVAGNANVLVFPDLQTGNIGYKLVQRFAKAKAIGPICQ 300 DGE+ D A+D E+ + P + ANVLV P L + +I KL+Q+ IGPI Sbjct: 677 DGEMAADVALDPELLS-HFPFCRLKAPANVLVMPGLYSAHIASKLLQKLGGTSVIGPILV 735 Query: 301 GFAKPINDLSRGCSSEDIVNVVAITVVQAQR 331 G +KP+ S S+ DIVN+ + A R Sbjct: 736 GLSKPVQITSMDASANDIVNMAVLASYDAVR 766 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 766 Length adjustment: 34 Effective length of query: 299 Effective length of database: 732 Effective search space: 218868 Effective search space used: 218868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory