Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_011384263.1 AMB_RS09395 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >NCBI__GCF_000009985.1:WP_011384263.1 Length = 273 Score = 152 bits (383), Expect = 1e-41 Identities = 88/227 (38%), Positives = 128/227 (56%), Gaps = 9/227 (3%) Query: 4 PASRSSFNPRGRHVGSLQLKTIRKAFGSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLR 63 P RS RGR + ++ + +FG+H ++ L+++ GEFV +GPSGCGKST L Sbjct: 5 PNRRSLTVTRGR----IGIQRLSVSFGAHAAVEDFSLEIEPGEFVCLLGPSGCGKSTALN 60 Query: 64 TIAGLEDATSGSVQIDGVEVGHVAPAKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPK 123 +AG G V +DGVEV P + MVFQ ++L+P TV +N+ G + G + Sbjct: 61 AVAGFLRPARGRVAVDGVEVTGPGPER---GMVFQQHSLFPWKTVLENVAFGPRMQGKTR 117 Query: 124 AEIEEKVAKAAGMLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAA 183 AE + + ++ L R PA LSGG QRV I RA+V P + L DEP LDA Sbjct: 118 AEARDLAREYLDLVGLGGSAQRYPAALSGGMAQRVGIARALVNHPSVLLMDEPFGALDAQ 177 Query: 184 LRVNTRLEIARLHRSLKATMIYVTHDQVEAMTLADKIVVLNA--GRI 228 R + + RL + T+++VTHD EA+ LAD++VV++A GR+ Sbjct: 178 TRSIMQESLLRLWGQIGNTVLFVTHDIDEALFLADRVVVMSAAPGRV 224 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 273 Length adjustment: 27 Effective length of query: 325 Effective length of database: 246 Effective search space: 79950 Effective search space used: 79950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory