GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Magnetospirillum magneticum AMB-1

Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate WP_043743857.1 AMB_RS08150 phosphoenolpyruvate--protein phosphotransferase

Query= reanno::pseudo3_N2E3:AO353_04460
         (838 letters)



>lcl|NCBI__GCF_000009985.1:WP_043743857.1 AMB_RS08150
           phosphoenolpyruvate--protein phosphotransferase
          Length = 757

 Score =  269 bits (687), Expect = 5e-76
 Identities = 176/521 (33%), Positives = 260/521 (49%), Gaps = 11/521 (2%)

Query: 309 NAEEQLQALDRALEQVRSEIRETLSHAKKHKHTEEEQIFAAHLALLEDPALLEAAIQSID 368
           + + +L+ L +AL  ++  + E  S  +  +  E   +   +    ED   L    ++I 
Sbjct: 216 DTDAELERLKKALTGIKLALEELFSRPEM-RDGEHRDVLETYRMFAEDKGWLNRISEAIH 274

Query: 369 QGSAATHAWSQSIEAQCEVLQQLGNPLLAERANDLRDLRQRVLRALLGQDWHY-----DV 423
            G  A  A  +  +     + Q+ +P L ER +D  DL  R+L+ L G D        D+
Sbjct: 275 TGLTAEAAVQKVHDDTRARMSQITDPYLRERMHDFEDLANRLLQHLAGGDDDQRPGAADL 334

Query: 424 PAGAIVAAHELTPSDLLQLSQQGVAGLCMAEGGATSHVAILARGKGLPCLVALSASLLQQ 483
           P GAI+    L P +L     + + GL + EG ATSHVAI+AR   +P +  +   L + 
Sbjct: 335 PEGAILIGRNLGPMELFDYDPKRLRGLVLEEGSATSHVAIVARALDIPVVGRVKDVLDKI 394

Query: 484 PQGQSVVLDADGGRLELTPDSQRLEQVAQAQREHLQRRERQQAQAHTPAHTRDGLRIEVA 543
                V+ D D G++ + P     E    A  +   R+         PA TR  +RI + 
Sbjct: 395 EPLDPVICDGDNGQVFIRPPDDIRETYIDAISQRQLRQAVYARLRELPAVTRQDVRIGIH 454

Query: 544 ANVASSNEAADALKGGADGVGLLRTEFLFVDRQTAPDEQEQRQAYQAVLDAMGDKSVIIR 603
            N     +       GADG+GL RTE  F+ R + PD   Q   Y+ +LD    K V+ R
Sbjct: 455 MNAGLLLDLQHLHDSGADGIGLYRTELPFMARSSLPDVAAQTLLYKKILDQAEGKPVVFR 514

Query: 604 TIDVGGDKQLDYLPLPAEANPVLGLRGIRMAQVRPELLDQQLRALLQVSPLQRCRILLPM 663
           T+DVGGDK L Y     E NP LG R IR+   RP ++  QLRALL+ +  +   ++ PM
Sbjct: 515 TLDVGGDKVLPYWNPYEEDNPALGWRSIRITLDRPAVMRSQLRALLRAAQGRELSVMFPM 574

Query: 664 VTEVDELLYIRQRLD-ALCAELA----LTQRLELGVMIEVPAAALLAEQLAEHADFLSIG 718
           + EV E +  R  LD  L  E A    +  RL++G M+EVPA AL  + L    DF+SIG
Sbjct: 575 IAEVSEFVQARLILDKELERERAMGNPMPSRLKVGTMLEVPALALQLDALLPMVDFVSIG 634

Query: 719 TNDLSQYTLAMDRDHAGLAARVDALHPALLRLIAQTCIGAAKHQRWVGVCGALASDPLAT 778
           +NDL+Q+  A+DR +  +A R D+L PA++R +       A++   + VCG +A  PL  
Sbjct: 635 SNDLTQFLFAVDRGNPRIAERYDSLAPAMVRFMRYVAAKCAQYGVTLSVCGEMAGRPLEA 694

Query: 779 PVLIGLGISELSVSPPQVGEIKERVRQLDAADCRRFSATLL 819
             LIG+GI  LS+S P +G +K  VR LD      +  TLL
Sbjct: 695 MALIGVGIRHLSLSAPNIGPVKTMVRSLDIGALEAYMNTLL 735


Lambda     K      H
   0.318    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1273
Number of extensions: 67
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 838
Length of database: 757
Length adjustment: 41
Effective length of query: 797
Effective length of database: 716
Effective search space:   570652
Effective search space used:   570652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory