Align Glucose kinase (characterized, see rationale)
to candidate WP_011384511.1 AMB_RS10655 glucokinase
Query= uniprot:Q8P6S9 (338 letters) >NCBI__GCF_000009985.1:WP_011384511.1 Length = 321 Score = 199 bits (506), Expect = 8e-56 Identities = 113/313 (36%), Positives = 164/313 (52%), Gaps = 7/313 (2%) Query: 19 VAADVGGTHVRLALACESNDPRKPVTVLDYRKYRCADYPGLAEIMAAFFAELSCAPVRRG 78 + AD+GGTH R AL + PV + RCADY G A + A+ AE + +G Sbjct: 6 LVADIGGTHARFALMGPDGEAVNPVVL------RCADYDGPAPAIKAYLAEHAGGVAPKG 59 Query: 79 VIASAGYALEDGRVITANLPWVLAPEQIRQQLGMQALHLVNDFEAVAYAANYMTGNQVMQ 138 + ++ R+ N PW + + RQ +G+Q L +VNDF AVA + ++ +M Sbjct: 60 GAFAVASVIDGDRIELTNSPWRFSIAETRQAVGLQRLEVVNDFTAVALSVRHLKPEHLMS 119 Query: 139 LSGPAQGAPGPALVLGPGTGLGAALWIPNG-GNSVVLPTEAGHAALAAASDLEVALLQEL 197 + G A P VLGPGTGLG + IP+ G L TE GH +AAA++ E +L L Sbjct: 120 VGGGMPEAGLPIAVLGPGTGLGVSALIPSASGEWTALATEGGHVTMAAATEREARILDRL 179 Query: 198 RRTRTHVATEHFLSGPGLLTLYTALATLRDAPAVHATPAAVTAAALAGDDVLAHEALQTF 257 R HV+ E LSG GL+ LY A+A L AV +TP +T L G ++ EA++ F Sbjct: 180 RTQFDHVSAERVLSGQGLVNLYQAVAALSGHQAVFSTPDVITKRGLDGSCPVSREAVEVF 239 Query: 258 CGFMGSVVGDMMLLYGVRSGVYLAGGFLPQIADFIARSDFAARLLDKGPLRPALEQVPVR 317 MG+V G++ L G + GV++AGG LP++A+ S F R G +P L +P Sbjct: 240 FAMMGTVAGNLALSLGAKGGVFIAGGILPRMAEAFRLSSFRTRFEAHGRFQPYLAAIPTW 299 Query: 318 IVEHGQLGVIGAA 330 ++ H +G A Sbjct: 300 LITHPLPAFVGLA 312 Lambda K H 0.321 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 321 Length adjustment: 28 Effective length of query: 310 Effective length of database: 293 Effective search space: 90830 Effective search space used: 90830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory