Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_011385250.1 AMB_RS14465 branched-chain amino acid ABC transporter permease
Query= TCDB::P74318 (286 letters) >NCBI__GCF_000009985.1:WP_011385250.1 Length = 286 Score = 121 bits (304), Expect = 2e-32 Identities = 89/286 (31%), Positives = 145/286 (50%), Gaps = 20/286 (6%) Query: 7 IFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWW-ANTSGINLWLSMAL 65 + NG+ G ++ L A GLTL +GI+ + N AHG F L AYL +W A T+G +L ++ L Sbjct: 10 VLNGVQYGLLLFLVASGLTLIFGIMGIINLAHGAFYMLGAYLAYWLARTTG-SLGAAVLL 68 Query: 66 GCVGTIIAMFIG---EWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNNQNYR 122 IA IG E LL + + R ++++ GL L +IWG + Sbjct: 69 SLP---IAAAIGYGIEALLVRTLYRR--DHLDQVLLTYGLILIFNEATRMIWGADVHGVA 123 Query: 123 VPIVPAQDFM---GIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDLAKV 179 VP + + YRL++ + V ++L++ RT+ G +RA A N D+ Sbjct: 124 VPAALNWSIRLTDTLSYPVYRLMLSGVCAVLAVGMYLVITRTRFGMWVRAGASNRDMVAA 183 Query: 180 SGINVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVILGGIGNPYGA 239 GINV+ + + + A L L G++ +T++ P MG +++ F V++GG+G+ GA Sbjct: 184 LGINVKLLFGVVFALGAALAGLAGAISTPITSVAPGMGDSVLILCFVVVVIGGVGSIKGA 243 Query: 240 IAGGIIIGVAQ---EVSVPWFGTSYKMGVALLLMIIILFIRPQGLF 282 G ++IG+A +V P F + GV M +L +P+GLF Sbjct: 244 FLGAMLIGLADTFGKVFAPDFASFTVYGV----MAAVLLWKPRGLF 285 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 286 Length adjustment: 26 Effective length of query: 260 Effective length of database: 260 Effective search space: 67600 Effective search space used: 67600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory