Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_011382581.1 AMB_RS00675 KR domain-containing protein
Query= reanno::BFirm:BPHYT_RS16920 (266 letters) >NCBI__GCF_000009985.1:WP_011382581.1 Length = 238 Score = 101 bits (252), Expect = 1e-26 Identities = 77/251 (30%), Positives = 117/251 (46%), Gaps = 24/251 (9%) Query: 21 SLVDRTVLITGGATGIGASFVEHFAAQGARVAFFDIDASAGEALADELGDSKHKPLFLSC 80 SL + L+TGG GIGA+ A GA+V G+ +L+ Sbjct: 3 SLAGKLALVTGGTRGIGAAIAARLLADGAKVMVTGTRPG---------GEGPAGSGYLAV 53 Query: 81 DLTDIDALQKAIADVKAALGPIQVLVNNAANDKRHTIGEVTRESFDAGIAVNIRHQFFAA 140 D D A A A+ A LG + +LVNNA +K E+ F VN+ F A Sbjct: 54 DFADA-AATTAFAEQAAGLG-VDILVNNAGINKVSPFAEIDPADFARIQQVNVTAPFLLA 111 Query: 141 QAVMEDMKAANSGSIINLGSISWMLKNGGYPVYVMSKSAVQGLTRGLARDLGHFNIRVNT 200 +AV+ M+A G I+ + SI + G Y SK AV GLT LA ++ F I N Sbjct: 112 RAVVPGMQAKAWGRIVTVSSIWGRISRAGRGAYSASKFAVDGLTAALAAEVAQFGILANC 171 Query: 201 LVPGWVMTEKQKRLWLDDAGRRSIKEGQCIDAEL------EPADLARMALFLAADDSRMI 254 + PG++ TE +++ G IKE + A++ P ++A +LA ++ I Sbjct: 172 VAPGFIDTELTRQV----LGEDGIKE---LTAQVPARRLGRPEEIAAFVAWLAGPENSYI 224 Query: 255 TAQDIVVDGGW 265 + Q++V+DGG+ Sbjct: 225 SGQNLVIDGGF 235 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 238 Length adjustment: 24 Effective length of query: 242 Effective length of database: 214 Effective search space: 51788 Effective search space used: 51788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory