Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_011385057.1 AMB_RS13470 3-hydroxybutyrate dehydrogenase
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >NCBI__GCF_000009985.1:WP_011385057.1 Length = 260 Score = 113 bits (283), Expect = 4e-30 Identities = 80/255 (31%), Positives = 122/255 (47%), Gaps = 8/255 (3%) Query: 19 LKNKVVLLTGAAQGIGEAIVATFASQQARLVISDI-QGEKVEKVAAHW-REQGADVVAIK 76 L K L+TG+ GIG I A+Q A ++++ G ++E + A +E G V+ Sbjct: 2 LNGKRALVTGSTSGIGLGIARALAAQGASVMLNGFGDGAEIEALRAGLAKEFGVTVLYNG 61 Query: 77 ADVSRQQDLHAMARLAIELHGRIDVLVNCAGVNVFRDPLQMTEEDWHRCFAIDLDGAWYG 136 AD+S+ + R A G +D+LVN AG+ + E W AI+L + Sbjct: 62 ADLSKPDGAGVLVRDAEARLGGVDILVNNAGIQHVSPVEEFPLERWDAVIAINLTSVFQA 121 Query: 137 CKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRVN 196 +A LP M +G G IIN+AS H Y +KHG+LGLT+ +G+E A + N Sbjct: 122 IRAALPGMKARGWGRIINVASAHGLVASVNKSAYVASKHGVLGLTKVVGLETAETDVTCN 181 Query: 197 AIAPGYIET---QLNVD---YWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASD 250 AI PG++ T Q +D G A R + P ++ P ++ AVFL S Sbjct: 182 AICPGWVLTPLVQKQIDARAEAQGVPVEQAGRDLLSEKQPSKKFTTPEQIGDLAVFLCSG 241 Query: 251 EAPFINASCITIDGG 265 + + +T+DGG Sbjct: 242 AGANMTGTSLTMDGG 256 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 260 Length adjustment: 25 Effective length of query: 247 Effective length of database: 235 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory