Align ABC transporter for L-Arginine, putative ATPase component (characterized)
to candidate WP_011384493.1 AMB_RS10565 ABC transporter ATP-binding protein
Query= reanno::BFirm:BPHYT_RS07685 (263 letters) >NCBI__GCF_000009985.1:WP_011384493.1 Length = 257 Score = 157 bits (397), Expect = 2e-43 Identities = 95/255 (37%), Positives = 144/255 (56%), Gaps = 12/255 (4%) Query: 7 TEACKLAVQDIHKRYGDNEVLKGVSLNANKGDVISIIGASGSGKSTFLRCINFLERPNAG 66 T K+ + +HK +G VL G+ L+ +G+ + +IG SG+GKS L+CI L RP +G Sbjct: 2 TSVPKIELTGVHKAFGPKVVLDGIDLSVARGESVVVIGGSGTGKSVMLKCILGLLRPESG 61 Query: 67 QIVVDGEMVKTKTDRAGNLEVADHKQLQRIRTKLAMVFQHFNLWAHMNVLENIVEAPIHV 126 I +DGE D G K RI K M+FQ L+ + V EN+ I Sbjct: 62 SIRIDGE------DVVG----MGPKDRDRIMKKFGMLFQGGALFDSLKVWENVAFGLIQG 111 Query: 127 LGLKRKEAEDRAREYLEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMNPDVMLFDEPT 186 ++R +A D A E L +VGLA + PS LSGG Q+RV++ARA+A NP+++ FDEPT Sbjct: 112 QKMERAKARDIAIEKLAQVGLAASTGELSPSELSGGMQKRVSLARAIATNPEIIFFDEPT 171 Query: 187 SALDPELVGEVLKVMQKLAEE-GRTMIVVTHEMGFARNVSNHVMFLHQGRTEEEGLPAEV 245 + LDP + + ++ K +E G T + +TH+M AR +S+ + L++GR G PA+ Sbjct: 172 TGLDPIMADVINDLIVKCCKEVGATALSITHDMASARKISDRIAMLYKGRLIWVG-PAKD 230 Query: 246 LSAPRSERLKQFLSG 260 + +E + QF+ G Sbjct: 231 IDHSGNEYVDQFIHG 245 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 257 Length adjustment: 24 Effective length of query: 239 Effective length of database: 233 Effective search space: 55687 Effective search space used: 55687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory