GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astC in Magnetospirillum magneticum AMB-1

Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_011383255.1 AMB_RS04150 acetylornithine transaminase

Query= reanno::Koxy:BWI76_RS11670
         (406 letters)



>lcl|NCBI__GCF_000009985.1:WP_011383255.1 AMB_RS04150
           acetylornithine transaminase
          Length = 388

 Score =  332 bits (851), Expect = 1e-95
 Identities = 180/393 (45%), Positives = 243/393 (61%), Gaps = 11/393 (2%)

Query: 10  FDEWMMPVYAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAG 69
           F + ++PV+     I  +GEG+ L    G+ ++DF  G+AVNALGHAHPRLV AL  QAG
Sbjct: 2   FPDNLLPVFDRTDVIFEQGEGAWLTASDGRRFLDFGAGVAVNALGHAHPRLVAALEAQAG 61

Query: 70  KFWHTGNGYTNEPVLRLAKQLIDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKS 129
           K WH  N Y      R+A++LI A+FAD  FFCN+GAEA E  +K+AR+Y H     E++
Sbjct: 62  KLWHCSNLYRVPGQERVAERLIKASFADTAFFCNTGAEAMELVIKIARRYHHCAGRPERN 121

Query: 130 GIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAIYNDLDSAKALIDDNTCAVIV 189
            IVA   +FHGRT+ T++A G P Y + F P+     H  Y DL++A+  I  NT A++V
Sbjct: 122 RIVACTGSFHGRTIATLAAAGTPKYLEGFGPVAQGFDHVPYGDLEAARGAIGSNTAALLV 181

Query: 190 EPMQGEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLS 249
           EP+QGEGG+ PAD  +LRGLR L D    LL+ DEVQTG+GRTG+L+A+   G+ PD++ 
Sbjct: 182 EPVQGEGGIRPADPAYLRGLRALADQFGLLLLMDEVQTGIGRTGKLFAHEWSGIAPDVMG 241

Query: 250 TAKALGGGFPIGALLASERCASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLNGVK 309
            AK LGGGFP+GA+LA+E+ AS MT GTHG T+GGNPLA AVA  V   +     L  V+
Sbjct: 242 LAKGLGGGFPVGAVLATEKAASCMTPGTHGCTFGGNPLAMAVAEAVLDEVMAPGFLERVQ 301

Query: 310 QRHQWFCERLNAINARY-GLFKEIRGLGLLIG---CVLKDEYAGKAKAISNQAAEEGLMI 365
                   RL+ +  RY G   ++RG GL++G     +  E+  K  A        GL+ 
Sbjct: 302 AVAALLRGRLDDLARRYPGAIAQVRGQGLMLGLKTVPVNTEFNAKLFA-------AGLLA 354

Query: 366 LIAGANVVRFAPALIISEDEVNSGLDRFELACK 398
           + AG NVVR  P LII E EV   ++  +  C+
Sbjct: 355 VGAGDNVVRLVPPLIIGEAEVERAVEIIDGVCR 387


Lambda     K      H
   0.321    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 453
Number of extensions: 23
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 406
Length of database: 388
Length adjustment: 31
Effective length of query: 375
Effective length of database: 357
Effective search space:   133875
Effective search space used:   133875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory