Align Guanidinobutyrase; EC 3.5.3.7 (characterized)
to candidate WP_011383513.1 AMB_RS05595 agmatinase
Query= SwissProt::Q9I3S3 (319 letters) >NCBI__GCF_000009985.1:WP_011383513.1 Length = 297 Score = 207 bits (527), Expect = 3e-58 Identities = 115/271 (42%), Positives = 168/271 (61%), Gaps = 5/271 (1%) Query: 44 GVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDSLNVADIGDVAINTFNLLE 103 G+P D+G + RSG R GP+ +R S M+ G + +++AD+GD ++ ++ Sbjct: 28 GIPFDLGVTNRSGAREGPQAVRRASRMLADGANPAGWSDPAQMSIADLGDFSLALGDIPR 87 Query: 104 AVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFG 163 ++ +IEQ+ I GH L +GGDHTITL +LRA+ K+ G VGLVH DAH D FG Sbjct: 88 SLEMIEQQAAGI-GH---LLAVGGDHTITLALLRALVKRTGPVGLVHFDAHIDTWPDNFG 143 Query: 164 EKIAHGTTFRRAVEEDLLDCDRVVQIGLRAQGYTAEDFNWSRKQGFRVVQAEECWHKSLE 223 +K+AHG+ F A+ E L+D R++QIG+R+ E ++W+ QG +V AE+ + + Sbjct: 144 QKLAHGSPFFHALREGLVDPRRMIQIGIRSP-MPREVYDWTVGQGVTIVTAEQVHAQGPQ 202 Query: 224 PLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLDLIGC 283 + + VG G YLSFDID IDP APGTGTPE+GGL T Q M I+R GL +G Sbjct: 203 WVAEAIGRVVGEGLTYLSFDIDAIDPGQAPGTGTPEVGGLFTWQVMAILRRLAGLRFVGM 262 Query: 284 DLVEVSPPYDTTGNTSLLGANLLYEMLCVLP 314 D+VEV+P YD + T+L A++L++ L + P Sbjct: 263 DVVEVAPAYDVSEITALAAASILWQYLTLRP 293 Lambda K H 0.321 0.141 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 297 Length adjustment: 27 Effective length of query: 292 Effective length of database: 270 Effective search space: 78840 Effective search space used: 78840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory